PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g11600.2
Common NameDL, LOC4332058, Os03g0215200, OsJ_009541
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family YABBY
Protein Properties Length: 195aa    MW: 21663.9 Da    PI: 8.7234
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g11600.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY57.65.4e-18146146
             YABBY  1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsll 46
                      +d++s se++Cyv+C++Cnt+lav vP + l+ +vtv+CGhC +l 
  LOC_Os03g11600.2  1 MDLVSPSEHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLS 46
                      578999************************************9984 PP

2YABBY93.35.9e-298114598162
             YABBY  98 seklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWah 162
                          +s  ++e +pr+p v++PPek+ r Psaynrf++eeiqrika+ Pdi hreafs+aaknWa 
  LOC_Os03g11600.2  81 LPLVSPTSNEGSPRAPFVVKPPEKKHRLPSAYNRFMREEIQRIKAAKPDIPHREAFSMAAKNWAK 145
                       445577889999***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046906.3E-456146IPR006780YABBY protein
SuperFamilySSF470952.36E-892147IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.9E-5100147IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MDLVSPSEHL CYVRCTYCNT VLAVGVPCKR LMDTVTVKCG HCNNLSFLSP RPPMVQPLSP  60
TDHPLGPFQG PCTDCRRNQP LPLVSPTSNE GSPRAPFVVK PPEKKHRLPS AYNRFMREEI  120
QRIKAAKPDI PHREAFSMAA KNWAKCDPRC SSTVSTSNSN PEPRVVAAPI PHQERANEQV  180
VESFDIFKQM ERSG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497730.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO406454100.0
Expression AtlasQ76EJ0-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected during flower and leaf development. Expression in the flower meristem in the early stage of flower development. When carpel primordia begin to form, specific and uniform expression in carpel primordia. Expression in the central region of the leaf plastochron 1 (P1) primordia. Detected up to P4 stage, hardly detected in the P5 leaves. {ECO:0000269|PubMed:14729915}.
Functional Description ? help Back to Top
Source Description
UniProtRegulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}.
Function -- GeneRIF ? help Back to Top
  1. By comparing expression profiles in the shoot apex that involves the leaf primordia, 90 genes were found that are upregulated at least two-fold higher in the transgenic plants overexpressing DROOPING LEAF.
    [PMID: 18670135]
  2. DL and OsETT2 act independently in awn formation, and that either gene alone is not sufficient for awn development.
    [PMID: 24330191]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g11600.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g11600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY4947130.0AY494713.1 Oryza sativa (japonica cultivar-group) drooping leaf (DL) mRNA, complete cds.
GenBankAB1065530.0AB106553.1 Oryza sativa Japonica Group DROOPING LEAF mRNA for DL protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630076.11e-143PREDICTED: protein DROOPING LEAF isoform X2
SwissprotQ76EJ01e-145YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLA0A0D3FFG01e-143A0A0D3FFG0_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9Z3Y21e-143A0A0D9Z3Y2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0CX851e-143A0A0E0CX85_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GJ001e-143A0A0E0GJ00_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NRK21e-143A0A0E0NRK2_ORYRU; Uncharacterized protein
TrEMBLA2XDY01e-143A2XDY0_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA012115-PA1e-142(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.12e-54YABBY family protein
Publications ? help Back to Top
  1. Nagasawa N, et al.
    SUPERWOMAN1 and DROOPING LEAF genes control floral organ identity in rice.
    Development, 2003. 130(4): p. 705-18
    [PMID:12506001]
  2. Yamaguchi T, et al.
    The YABBY gene DROOPING LEAF regulates carpel specification and midrib development in Oryza sativa.
    Plant Cell, 2004. 16(2): p. 500-9
    [PMID:14729915]
  3. Toriba T, et al.
    Molecular characterization the YABBY gene family in Oryza sativa and expression analysis of OsYABBY1.
    Mol. Genet. Genomics, 2007. 277(5): p. 457-68
    [PMID:17216490]
  4. Abiko M,Ohmori Y,Hirano HY
    Genome-wide expression profiling and identification of genes under the control of the DROOPING LEAF gene during midrib development in rice.
    Genes Genet. Syst., 2008. 83(3): p. 237-44
    [PMID:18670135]
  5. Toriba T,Hirano HY
    The DROOPING LEAF and OsETTIN2 genes promote awn development in rice.
    Plant J., 2014. 77(4): p. 616-26
    [PMID:24330191]