PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g11600.1
Common NameLOC4332058, Os03g0215200, OsJ_09912, OSNPB_030215200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family YABBY
Protein Properties Length: 197aa    MW: 21905.2 Da    PI: 8.7234
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g11600.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY51.25.1e-16148146
             YABBY  1 advfssseqvCyvqCnfCntila..vsvPstslfkvvtvrCGhCtsll 46
                      +d++s se++Cyv+C++Cnt+la  v vP + l+ +vtv+CGhC +l 
  LOC_Os03g11600.1  1 MDLVSPSEHLCYVRCTYCNTVLAlqVGVPCKRLMDTVTVKCGHCNNLS 48
                      578999***************9744778****************9984 PP

2YABBY93.64.9e-298314798162
             YABBY  98 seklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWah 162
                          +s  ++e +pr+p v++PPek+ r Psaynrf++eeiqrika+ Pdi hreafs+aaknWa 
  LOC_Os03g11600.1  83 LPLVSPTSNEGSPRAPFVVKPPEKKHRLPSAYNRFMREEIQRIKAAKPDIPHREAFSMAAKNWAK 147
                       445577889999***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046906.9E-436148IPR006780YABBY protein
SuperFamilySSF470952.36E-894149IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.9E-5102149IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MDLVSPSEHL CYVRCTYCNT VLALQVGVPC KRLMDTVTVK CGHCNNLSFL SPRPPMVQPL  60
SPTDHPLGPF QGPCTDCRRN QPLPLVSPTS NEGSPRAPFV VKPPEKKHRL PSAYNRFMRE  120
EIQRIKAAKP DIPHREAFSM AAKNWAKCDP RCSSTVSTSN SNPEPRVVAA PIPHQERANE  180
QVVESFDIFK QMERSG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497730.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO406454100.0
Expression AtlasQ10Q01-
Function -- GeneRIF ? help Back to Top
  1. By comparing expression profiles in the shoot apex that involves the leaf primordia, 90 genes were found that are upregulated at least two-fold higher in the transgenic plants overexpressing DROOPING LEAF.
    [PMID: 18670135]
  2. DL and OsETT2 act independently in awn formation, and that either gene alone is not sufficient for awn development.
    [PMID: 24330191]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g11600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g11600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY4947130.0AY494713.1 Oryza sativa (japonica cultivar-group) drooping leaf (DL) mRNA, complete cds.
GenBankAB1065530.0AB106553.1 Oryza sativa Japonica Group DROOPING LEAF mRNA for DL protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630075.11e-144PREDICTED: protein DROOPING LEAF isoform X1
SwissprotQ76EJ01e-134YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLI1P8W41e-144I1P8W4_ORYGL; Uncharacterized protein
TrEMBLQ10Q011e-144Q10Q01_ORYSJ; Drooping leaf protein, putative, expressed
STRINGLOC_Os03g11600.11e-144(Oryza sativa Japonica Group)
STRINGORGLA03G0081000.11e-144(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP90691114
MonocotsOGMP59513657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.13e-52YABBY family protein
Publications ? help Back to Top
  1. Yamaguchi T, et al.
    The YABBY gene DROOPING LEAF regulates carpel specification and midrib development in Oryza sativa.
    Plant Cell, 2004. 16(2): p. 500-9
    [PMID:14729915]
  2. Abiko M,Ohmori Y,Hirano HY
    Genome-wide expression profiling and identification of genes under the control of the DROOPING LEAF gene during midrib development in rice.
    Genes Genet. Syst., 2008. 83(3): p. 237-44
    [PMID:18670135]
  3. Toriba T,Hirano HY
    The DROOPING LEAF and OsETTIN2 genes promote awn development in rice.
    Plant J., 2014. 77(4): p. 616-26
    [PMID:24330191]