PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g10210.1
Common NameHOX12, LOC4331956, Os03g0198600, OsJ_009423
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 240aa    MW: 26081.3 Da    PI: 6.9419
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g10210.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.88.8e-1961114356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++++eq + Le  F+k+r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  LOC_Os03g10210.1  61 KKRRLSDEQARFLEMSFKKERKLETPRKVQLAAELGLDAKQVAVWFQNRRARHK 114
                       56689***********************************************99 PP

2HD-ZIP_I/II113.71.2e-3661151292
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       kkrrls+eq+++LE+sF++e+kLe+ rKv+la eLgl+++qvavWFqnrRAR+k+k +E+++++L++a+da++ +n++Le+e  +L+e+l+
  LOC_Os03g10210.1  61 KKRRLSDEQARFLEMSFKKERKLETPRKVQLAAELGLDAKQVAVWFQNRRARHKSKLMEEEFAKLRSAHDAVVLQNCHLETELLKLKERLA 151
                       9**************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.82756116IPR001356Homeobox domain
SuperFamilySSF466899.8E-1756115IPR009057Homeodomain-like
SMARTSM003891.6E-1659120IPR001356Homeobox domain
CDDcd000867.32E-1661116No hitNo description
PfamPF000462.8E-1661114IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.1E-1761114IPR009057Homeodomain-like
PRINTSPR000315.3E-68796IPR000047Helix-turn-helix motif
PROSITE patternPS00027091114IPR017970Homeobox, conserved site
PRINTSPR000315.3E-696112IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MSREEDEKLL FPSFAFPAEC FPEAATSGGE QKKARQRRRR KVKPEAAAAL AGESGGDEQA  60
KKRRLSDEQA RFLEMSFKKE RKLETPRKVQ LAAELGLDAK QVAVWFQNRR ARHKSKLMEE  120
EFAKLRSAHD AVVLQNCHLE TELLKLKERL ADVEEEKAKL AAVAAATTGG GGGGGGGSSS  180
PTSSSFSTVT YHPALAGQFG VEAAAEEADL TYMSEYAYNS YMLELAAAGY CGGVYDQFS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167177TGGGGGGGGGS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.90860.0callus| leaf| panicle| root| seed| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329834690.0
Expression AtlasQ10QF2-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g10210.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g10210
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0734460.0AK073446.1 Oryza sativa Japonica Group cDNA clone:J033043C24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629042.11e-173PREDICTED: homeobox-leucine zipper protein HOX12
SwissprotQ10QF21e-175HOX12_ORYSJ; Homeobox-leucine zipper protein HOX12
TrEMBLA0A0D3FF181e-173A0A0D3FF18_9ORYZ; Uncharacterized protein
TrEMBLI1P8J81e-173I1P8J8_ORYGL; Uncharacterized protein
STRINGLOC_Os03g10210.11e-173(Oryza sativa Japonica Group)
STRINGORGLA03G0069400.11e-173(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP37761025
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.16e-29homeobox protein 40
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]