PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g09280.1
Common NameLOC4331920, Os03g0193000, OsJ_09743, OSNPB_030193000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 536aa    MW: 59647.9 Da    PI: 6.2584
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g09280.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS418.65.5e-1281675352374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++++ +c +av++++    + l+++l++++s +g+pmqRl ay++e+L arl+++++ lyk+l+++e +   s e +++++l++e++P++kf+
  LOC_Os03g09280.1 167 KQVIAACGKAVDENS-WYRDLLISELRNMVSISGEPMQRLGAYMLEGLVARLSSTGHALYKSLKCKEPT---SFELMSYMHLLYEICPFFKFG 255
                       677888999998854.4568899*********************************************9...99999**************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       ++ aN aI eav+ge+ vHiiDf+i qG QW++++qaLa+Rp+gpp lRiTg+++++s   +   l  +g+rL ++A+++g+pfefn+ v  +
  LOC_Os03g09280.1 256 YMSANGAIAEAVKGENFVHIIDFQIAQGSQWATMIQALAARPGGPPYLRITGIDDSNSAhaRGGGLDIVGRRLFNIAQSCGLPFEFNA-VPAA 347
                       *******************************************************8888889999***********************.7999 PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                        +++ le+L++++gE+++Vn+++qlh+++desv +e++rd++L++vk+lsP+vv++veqea++n+++F++r le+l+yy+a+f+++++  pr+
  LOC_Os03g09280.1 348 SHEVMLEHLDIRSGEVIVVNFAYQLHHTPDESVGIENHRDRILRMVKGLSPRVVTLVEQEANTNTAPFFNRYLETLDYYTAMFEAIDVACPRD 440
                       99999**************************************************************************************** PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       +++ri+ E+++++r+ivn++acegaer+erhe ++kWr+rl++aGF+p+pls  +++++k ll  ++s  y++ee++g+l+lgWk+r+Lv+ S
  LOC_Os03g09280.1 441 DKKRISTEQHCVARDIVNLIACEGAERVERHEPFGKWRARLSMAGFRPYPLSALVNNTIKKLLDSYHSY-YKLEERDGALYLGWKNRKLVVSS 532
                       *******************************************************************66.*********************** PP

              GRAS 372 aWr 374
                       aWr
  LOC_Os03g09280.1 533 AWR 535
                       **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.845140516IPR005202Transcription factor GRAS
PfamPF035141.9E-125167535IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MSMQASNRPY RYPDNSQIPY YSRSSMHVGQ NGTYHVQQNH EDLYASSDDG SQNGNSKAQG  60
LQAQYCTLDS SSGNFVYPAH SSTSSHISGS PISQQDSHSE HTSGSPASAS CVTEVPGLRF  120
TTIEEIENAM FGPEPDTVSS DCSLLTDSAF YQDNWREHLG INTGDLKQVI AACGKAVDEN  180
SWYRDLLISE LRNMVSISGE PMQRLGAYML EGLVARLSST GHALYKSLKC KEPTSFELMS  240
YMHLLYEICP FFKFGYMSAN GAIAEAVKGE NFVHIIDFQI AQGSQWATMI QALAARPGGP  300
PYLRITGIDD SNSAHARGGG LDIVGRRLFN IAQSCGLPFE FNAVPAASHE VMLEHLDIRS  360
GEVIVVNFAY QLHHTPDESV GIENHRDRIL RMVKGLSPRV VTLVEQEANT NTAPFFNRYL  420
ETLDYYTAMF EAIDVACPRD DKKRISTEQH CVARDIVNLI ACEGAERVER HEPFGKWRAR  480
LSMAGFRPYP LSALVNNTIK KLLDSYHSYY KLEERDGALY LGWKNRKLVV SSAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-581635351375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.52520.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329834090.0
Expression AtlasQ10QK3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g09280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g09280
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1507510.0AC150751.1 Oryza sativa Japonica Group chromosome 3 clone OSJNOa0279P04, complete sequence.
GenBankAC1166040.0AC116604.1 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBb0019D17, from chromosome 3, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAK0733860.0AK073386.1 Oryza sativa Japonica Group cDNA clone:J033041E22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630858.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630859.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630860.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630861.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630862.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015630863.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLB8AQ190.0B8AQ19_ORYSI; Putative uncharacterized protein
TrEMBLQ10QK30.0Q10QK3_ORYSJ; Chitin-inducible gibberellin-responsive protein 2, putative, expressed
STRINGLOC_Os03g09280.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA012030-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14091447
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein