PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g08370.1
Common NameLOC4331837, Os03g0181600, OSNPB_030181600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 733aa    MW: 83391 Da    PI: 7.6763
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g08370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA39.76.7e-133066135
              GATA  1 CsnCgttk..TplWRrgpdgnktLCnaCGlyyrkkgl 35
                      C  Cg +   Tp++Rrgp+g +tLCnaCG+ ++k ++
  LOC_Os03g08370.1 30 CLRCGISAnaTPHMRRGPEGRRTLCNACGIAWAKGKV 66
                      5567766667************************986 PP

2FAR189.54.7e-28100185188
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                       +fYn+YA +vGFsvrks+s ks +n  + +rtfvCs+eg+r+++k + ++ +r+r+etr+gC a++ +k ++dgk+++++++ +HnH+
  LOC_Os03g08370.1 100 EFYNRYAGHVGFSVRKSSSDKSAENI-TRSRTFVCSREGFRKDKKGA-KEVKRPRPETRIGCPARMSIKITSDGKYRISEFVPDHNHQ 185
                       6*********************6665.99**************9999.999************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.42E-92381No hitNo description
SMARTSM004014.8E-62478IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.6E-112966IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.3E-103266IPR000679Zinc finger, GATA-type
PfamPF031018.4E-25100185IPR004330FAR1 DNA binding domain
PfamPF105514.9E-24309405IPR018289MULE transposase domain
PROSITE profilePS509669.829579626IPR007527Zinc finger, SWIM-type
PfamPF044343.2E-4596623IPR007527Zinc finger, SWIM-type
SMARTSM005757.5E-4601628IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MQFEDGGDVH VGAGEGEDGG RVTVDELTRC LRCGISANAT PHMRRGPEGR RTLCNACGIA  60
WAKGKVRKVI DSDTPMDNAM FAQMVPELSM EFDDEDKAYE FYNRYAGHVG FSVRKSSSDK  120
SAENITRSRT FVCSREGFRK DKKGAKEVKR PRPETRIGCP ARMSIKITSD GKYRISEFVP  180
DHNHQPAPPS TMHMLRSQRV LTELQTTEAD SSEESATPSR FSSCSLVKQA EVIRHTNFLP  240
AEYRCSLCSK RKKNMQPGDA GVTVKYLQSM QLSNPSFFYA VQLDEDDKLT NIFWADSKSR  300
TDFSYYSDVV CLDTTYKINE HSRPLTLFLG VNHHKQISIF GAALLYDESE ESFKWLFDTF  360
KIAANGKQPK TILTDWSMAA TTASAITAAW PGTVHRLCPW QVYQNSVKHL NHIFQGSKTF  420
AKDFGKCVYD YDDEENFLLG WNTMLEKYDL RNNEWIKKIF DDRDKWSPVY NRHVFTADIK  480
SSLQSESVRN ALKKSLSPQF DLLSFFKHYE RMLDEFRYAE LQADFHASQS FPRIPPSKML  540
RQAANMYTPV VFEIFRREFE MFVDSVIYSC GEDGNAFEYR VAVTDRPGEH YVRFDSGDLS  600
VVCSCKKFEA MGIQCCHVLK VLDFRNIKEL PQKYFMKRWK KDVKSASTGN QELLNGGVSQ  660
IPSSYLNVPV PFIDPQHVQS NNELNHDTSV SNSHQQALHG GAQGSQGYAP LAGIQQQQFI  720
GNFRLNHETG FL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148152KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.332560.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329778250.0
Expression AtlasQ10QV7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g08370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g08370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0678070.0AK067807.1 Oryza sativa Japonica Group cDNA clone:J013120L22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633159.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
TrEMBLQ10QV70.0Q10QV7_ORYSJ; Os03g0181600 protein
STRINGLOC_Os03g08370.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-118FAR1-related sequence 5