PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g07880.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 167aa    MW: 18637.4 Da    PI: 11.0203
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g07880.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1087.7e-3464120158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep+YVNaKQy++Il+RRq Rakle+e+kl  k+rkpylheSRh+hA++R+Rg+gGrF
  LOC_Os03g07880.3  64 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKNRKPYLHESRHQHAMKRARGTGGRF 120
                       69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.8E-3962123IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.28363123IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.6E-2965120IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.9E-256688IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068606888IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.9E-2597120IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MSRMINLVIL MVTRRVMKGI SYPYADSFYG GAVATYGTHA IMHPQIVGVM SSSRVPLPIE  60
PATEEPIYVN AKQYHAILRR RQLRAKLEAE NKLVKNRKPY LHESRHQHAM KRARGTGGRF  120
LNTKQQPEAS DGGTPRLVSA NGVVFSKHEH SLSSSDLHHR RAKEGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-2564134274NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.34260.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ10R13
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g07880.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g07880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8470060.0EU847006.1 Oryza sativa Japonica Group clone KCS364E08 CCAAT-binding transcription factor mRNA, complete cds.
GenBankCT8327050.0CT832705.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA105G23, full insert sequence.
GenBankAB2880290.0AB288029.1 Oryza sativa Japonica Group OsHAP2C mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0693480.0AK069348.1 Oryza sativa Japonica Group cDNA clone:J023014B08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631822.11e-106PREDICTED: nuclear transcription factor Y subunit A-7
SwissprotQ9LNP62e-38NFYA8_ARATH; Nuclear transcription factor Y subunit A-8
TrEMBLQ10R131e-120Q10R13_ORYSJ; CCAAT-binding transcription factor subunit B family protein, expressed
STRINGORGLA03G0053200.11e-106(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.42e-39nuclear factor Y, subunit A8