PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g07880.1
Common NameLOC4331796, Os03g0174900, OsJ_09616
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 240aa    MW: 26288.3 Da    PI: 9.3957
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g07880.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1071.5e-33137193158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep+YVNaKQy++Il+RRq Rakle+e+kl  k+rkpylheSRh+hA++R+Rg+gGrF
  LOC_Os03g07880.1 137 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKNRKPYLHESRHQHAMKRARGTGGRF 193
                       69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.8E-39135196IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.283136196IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.3E-29138193IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.8E-25139161IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860141161IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.8E-25170193IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MLPPHLTENG TVMIQFGHKM PDYESSATQS TSGSPREVSG MSEGSLNEQN DQSGNLDGYT  60
KSDEGKMMSA LSLGKSETVY AHSEPDRSQP FGISYPYADS FYGGAVATYG THAIMHPQIV  120
GVMSSSRVPL PIEPATEEPI YVNAKQYHAI LRRRQLRAKL EAENKLVKNR KPYLHESRHQ  180
HAMKRARGTG GRFLNTKQQP EASDGGTPRL VSANGVVFSK HEHSLSSSDL HHRRAKEGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-24137207274NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.34260.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ10R14
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g07880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g07880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8470060.0EU847006.1 Oryza sativa Japonica Group clone KCS364E08 CCAAT-binding transcription factor mRNA, complete cds.
GenBankCT8327050.0CT832705.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA105G23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631822.11e-178PREDICTED: nuclear transcription factor Y subunit A-7
TrEMBLA0A0E0CVZ91e-178A0A0E0CVZ9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GHJ61e-178A0A0E0GHJ6_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NQF11e-178A0A0E0NQF1_ORYRU; Uncharacterized protein
TrEMBLA2XD391e-178A2XD39_ORYSI; Putative uncharacterized protein
TrEMBLQ10R141e-178Q10R14_ORYSJ; CCAAT-binding transcription factor
STRINGLOC_Os03g07880.11e-177(Oryza sativa Japonica Group)
STRINGBGIOSGA011352-PA1e-177(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6801672
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.12e-44nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Thirumurugan T,Ito Y,Kubo T,Serizawa A,Kurata N
    Identification, characterization and interaction of HAP family genes in rice.
    Mol. Genet. Genomics, 2008. 279(3): p. 279-89
    [PMID:18193457]