PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g07360.1
Common NameLOC4331765, Os03g0169600, OsJ_09572, OSJNBa0091P11.8, OSNPB_030169600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 441aa    MW: 47001.7 Da    PI: 7.8021
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g07360.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.3e-39102162262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       ++k+l+cprC s++tkfCyynny+++qPr+fCk+C+ryWt+GGa+rnvPvG+grrk+k++s
  LOC_Os03g07360.1 102 PDKILPCPRCSSMDTKFCYYNNYNINQPRHFCKNCQRYWTAGGAMRNVPVGAGRRKSKSVS 162
                       7899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3298159IPR003851Zinc finger, Dof-type
PfamPF027013.6E-32104160IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.761106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MGECKVGGGG GGGDCLIKLF GKTIPVPEPG ACAAGDVDKD LQHSGSSTTE PKTQENTVQD  60
STSPPPQPEV VDTEDSSADK NSSENQQQQG DTANQKEKLK KPDKILPCPR CSSMDTKFCY  120
YNNYNINQPR HFCKNCQRYW TAGGAMRNVP VGAGRRKSKS VSAASHFLQR VRAALPGDPP  180
LYAPVKTNGT VLSFGSDLST LDLTEQMKHL KDKFIPTTGI KNTDEMPVGL CAEGLSKTEE  240
SNQTNLKEKV SADRSPNVAQ HPCMNGGAMW PFGVAPPPAY YTSSIAIPFY PAAAAAVAAY  300
WGCMVPGAWN APWPPQSQSQ SVSSSSAASP VSTMTNCFRL GKHPRDGDEE LDSKGNGKVW  360
VPKTVRIDDV DEVARSSIWS LIGIKGDKVG ADHGRGCKLA KVFESKDEAK ASTHTAISSL  420
PFMQGNPAAL TRSVTFQEGS *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.119870.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166320520.0
Expression AtlasQ8S7W1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g07360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g07360
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2244290.0AY224429.1 Oryza sativa (japonica cultivar-group) isolate 20575 putative H-protein promoter binding factor-2a mRNA, complete cds.
GenBankAK1045230.0AK104523.1 Oryza sativa Japonica Group cDNA clone:006-303-F03, full insert sequence.
GenBankAK0609000.0AK060900.1 Oryza sativa Japonica Group cDNA clone:001-035-D05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631794.10.0PREDICTED: cyclic dof factor 1
TrEMBLA0A0E0NQA60.0A0A0E0NQA6_ORYRU; Uncharacterized protein
TrEMBLQ8S7W10.0Q8S7W1_ORYSJ; Dof domain, zinc finger family protein, expressed
STRINGLOC_Os03g07360.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-66cycling DOF factor 2
Publications ? help Back to Top
  1. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]