PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g05760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family E2F/DP
Protein Properties Length: 232aa    MW: 26230 Da    PI: 6.3992
Description E2F/DP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g05760.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1E2F_TDP52.48.7e-1728603871
           E2F_TDP 38 dvknkrRRiYDilNVLealnliekkekneirwkg 71
                      d+kn+rRR+YD+lNVL+a+++i+k +k+ei+wkg
  LOC_Os03g05760.1 28 DEKNIRRRVYDALNVLMAMEIISK-DKKEIQWKG 60
                      899*********************.*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM013723.9E-7660IPR003316E2F/DP family, winged-helix DNA-binding domain
PIRSFPIRSF0094045.4E-8912231IPR015648Transcription factor DP
Gene3DG3DSA:1.10.10.103.1E-231665IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467854.49E-122061IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF023191.1E-142460IPR003316E2F/DP family, winged-helix DNA-binding domain
CDDcd144581.82E-3865168IPR014889Transcription factor DP, C-terminal
SMARTSM011388.4E-8067229IPR014889Transcription factor DP, C-terminal
SuperFamilySSF1440741.05E-4067185No hitNo description
PfamPF087811.2E-4168202IPR014889Transcription factor DP, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042023Biological ProcessDNA endoreduplication
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MNLLPNLQIP ITAFCHQIRI IPMQQQYDEK NIRRRVYDAL NVLMAMEIIS KDKKEIQWKG  60
LPRTSINDIE DLQTELVGLK SRIEKKNTYL QELQDQFVGM QKLIQRNEQL YGSGNIPSGG  120
VALPFILVQT RPHATVEVEI SEDMQLVHFD FNSTPFELHD DSFVLKAMSS CGEEQIDGIH  180
DLISNGGESS SMPNIYRQQV QQPARSTNGT ARLPSSPPIP GILKGRVKHE H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1cf7_B9e-1611653993PROTEIN (TRANSCRIPTION FACTOR DP-2)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.264170.0callus| flower| leaf| panicle| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g05760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g05760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2245890.0AY224589.1 Oryza sativa (japonica cultivar-group) isolate 31182 E2F dimerization factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628001.11e-152PREDICTED: transcription factor-like protein DPB isoform X1
SwissprotQ9FNY23e-87DPB_ARATH; Transcription factor-like protein DPB
TrEMBLI1P7N41e-152I1P7N4_ORYGL; Uncharacterized protein
STRINGORGLA03G0038000.11e-152(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP25111734
MonocotsOGMP128338109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03415.12e-88Transcription factor DP