PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g05160.1
Common NameLOC4331600, OJ1172F09.7, Os03g0145200, OSNPB_030145200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 220aa    MW: 23369.2 Da    PI: 9.02
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g05160.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.93.2e-19124157134
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                       C++C + +Tp+WR gpdg++tLCnaCG+++++ +
  LOC_Os03g05160.1 124 CTHCAVDETPQWRLGPDGPRTLCNACGVRFKSGR 157
                       *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.517118154IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-15118168IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.23E-15120182No hitNo description
Gene3DG3DSA:3.30.50.105.3E-14122155IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.41E-16124172No hitNo description
PROSITE patternPS003440124149IPR000679Zinc finger, GATA-type
PfamPF003201.5E-17124157IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MVGDKDAAAL AGELTGDAGA SLNGFFDHTG LESAVVGEGQ GEGEEEEELE WLSNKDAFPS  60
VDTMAAEVES AAPGAPARAA VGPRTKGLRR RRRVTAPWSL APLLSRPRQA AAAAADAGAP  120
RRRCTHCAVD ETPQWRLGPD GPRTLCNACG VRFKSGRLFP EYRPANSPTF SPLLHSNSHR  180
RVMEMRLQSE EDASAASRVN AKARRAERAA ARLAGKDKK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.64080.0callus| flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160121000.0
Expression AtlasQ8H036-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g05160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g05160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2427350.0AK242735.1 Oryza sativa Japonica Group cDNA, clone: J090048J08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629220.11e-156PREDICTED: GATA transcription factor 3
SwissprotQ8L4M68e-38GATA3_ARATH; GATA transcription factor 3
TrEMBLA0A0E0GGQ11e-156A0A0E0GGQ1_ORYNI; Uncharacterized protein
TrEMBLA2XCF91e-156A2XCF9_ORYSI; Putative uncharacterized protein
TrEMBLQ8H0361e-156Q8H036_ORYSJ; GATA zinc finger family protein
STRINGBGIOSGA011849-PA1e-156(Oryza sativa Indica Group)
STRINGLOC_Os03g05160.11e-156(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.23e-34GATA family protein