PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g04070.1
Common NameLOC4331520, Os03g0133000, OsJ_09306, OSNPB_030133000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 317aa    MW: 34927.3 Da    PI: 7.7186
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g04070.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.36.2e-49191453128
               NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                       pGfrFhPt+eel+++yL + v gkkl++ ++i +++iy+++PwdLp ++k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d+++ s+
  LOC_Os03g04070.1  19 PGFRFHPTEEELLDFYLSRVVLGKKLHF-NIIGTLNIYRHDPWDLPGMAKIGEREWYFFVPRDRKAGNGGRPNRTTERGFWKATGSDRAIRSS 110
                       9*************************99.89***************888999****************************************9 PP

               NAM  96 ..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++++glkktLvfy+grap+g+ktdWvm+eyrl
  LOC_Os03g04070.1 111 gdPKRVIGLKKTLVFYQGRAPRGTKTDWVMNEYRL 145
                       766778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5811170IPR003441NAC domain
PROSITE profilePS5100555.55217170IPR003441NAC domain
PfamPF023658.4E-2519145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MAAAVAVAGP SMEVEQDLPG FRFHPTEEEL LDFYLSRVVL GKKLHFNIIG TLNIYRHDPW  60
DLPGMAKIGE REWYFFVPRD RKAGNGGRPN RTTERGFWKA TGSDRAIRSS GDPKRVIGLK  120
KTLVFYQGRA PRGTKTDWVM NEYRLPDYGA ARAAAPPPKE DMVLCKIYRK ATPLKELEQR  180
ASAMEEMQRG SSHGDYTATR ASLVHDASAS TGDDYFSSDD VHDSGFLIQS SSSSAAPSGS  240
SSKNGGAGAP REAKKEEADV TVTVASATSL QLPAVSQLPS LQLPAMDWLQ DPFLTQLRSP  300
WQDQHCLSPY AHLLYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-501917219167NAC domain-containing protein 19
4dul_A6e-501917219167NAC domain-containing protein 19
1ut7_B6e-501917219167NO APICAL MERISTEM PROTEIN
1ut7_A6e-501917219167NO APICAL MERISTEM PROTEIN
1ut4_B6e-501917219167NO APICAL MERISTEM PROTEIN
1ut4_A6e-501917219167NO APICAL MERISTEM PROTEIN
3swp_D7e-501917222170NAC domain-containing protein 19
3swp_C7e-501917222170NAC domain-containing protein 19
3swp_B7e-501917222170NAC domain-containing protein 19
3swp_A7e-501917222170NAC domain-containing protein 19
3swm_D7e-501917222170NAC domain-containing protein 19
3swm_C7e-501917222170NAC domain-containing protein 19
3swm_B7e-501917222170NAC domain-containing protein 19
3swm_A7e-501917222170NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.213950.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329922990.0
Expression AtlasQ10S65-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g04070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g04070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1070900.0AK107090.1 Oryza sativa Japonica Group cDNA clone:002-121-G12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630174.10.0PREDICTED: NAC domain-containing protein 67-like
SwissprotQ9FIW57e-57NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A0D3FDG00.0A0A0D3FDG0_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NPA50.0A0A0E0NPA5_ORYRU; Uncharacterized protein
TrEMBLA2XC490.0A2XC49_ORYSI; Putative uncharacterized protein
TrEMBLI1P7970.0I1P797_ORYGL; Uncharacterized protein
TrEMBLQ10S650.0Q10S65_ORYSJ; No apical meristem protein, expressed
STRINGBGIOSGA011514-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g04070.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0024300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.17e-88NAC domain containing protein 36