PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g03900.1
Common NameLOC4331508, NLP1, OJ1004C08.16, Os03g0131100, OsJ_09292
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 943aa    MW: 104617 Da    PI: 5.6435
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g03900.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.42.8e-28620670252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek++sl+dl+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  LOC_Os03g03900.1 620 EKTVSLQDLRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 670
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029609690IPR003035RWP-RK domain
PfamPF020426.9E-26622670IPR003035RWP-RK domain
SuperFamilySSF542771.03E-22842926No hitNo description
Gene3DG3DSA:3.10.20.2401.1E-25842926No hitNo description
PROSITE profilePS5174523.255844927IPR000270PB1 domain
SMARTSM006662.0E-25844927IPR000270PB1 domain
CDDcd064073.28E-43845926No hitNo description
PfamPF005641.2E-17845926IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 943 aa     Download sequence    Send to blast
MEQKPSPPPP PRSDEEEDGL MGCGMGGTGD IAGGDLDLME EFLLATPGFD LSEFWHPGAA  60
SPFSPLFDIG SSVTTLTTPA PAAGEDDRDE AEMPSRGGGG LEVSPAHRGW TFQTAPQEVA  120
VEPTVKERLR RALERIASQS QSQAQRGDGE LLVQVWVPTR IGDRQVLTTC GQPFWLDRRN  180
QRLANYRTVS MKYQFSADES ARADLGLPGR VFVGRVPEWT PDVRYFSTEE YPRVQHAQYF  240
DIRGSVALPV FEPRSRACLG VVELVMTTQK VNYSAEIENI CNALKEVDLR SSDVSSDPRS  300
KVVDASYRAI IPEIMDVLRA VCDTHNLPLA QTWIPCICQA KRGSRHSDES YKHCVSTVDE  360
ACYVRDCSVL GFHQACSEHH LFRGEGVVGR AFGTNEPCFS PDITTYSKTQ YPLSHHAKLF  420
GLRAAVAIQL RSVKTGSLDF VLEFFLPMKC INTEEQRAML NSLSNTIQQV CYTLRVVKPK  480
ELVNDGPFEI SQPTRPEFYA KSVHEDLDEL CSGINVPGRT TSLEASEEVS SWIASLVDAQ  540
NKGGKGEIDV DLPFGFSKQD DEGFSVTAGW HTSPVMAPDG SMFSGFKRHE DYDVKENTCS  600
SDPSNSNSDK AVEKRRTKTE KTVSLQDLRK HFAGSLKEAA KNLGVCPTTL KRICRQHGIN  660
RWPSRKIKKV GHSLKKLQMV IDSVHGPEGT VQLSSLYENF TKTTWSEREL QGDVHFPASE  720
QNFQLEPSVP DRPCEGRFTS HTSGSNSISP SCSQSSNSSL GCSSVPKTQQ QHGSAPQLAV  780
KEEISMDENQ CSTLIKSASH AEAELQMFVE ERPTMLFRSQ SQVLLSEHKP IENMSNVQKA  840
RSDSLKIKAI YGEERCIFRL QPSWGFQRLK EEIVKRFGIS QDTHVDLKYL DDESEWVLLT  900
CDADLLECID VYKSSSNQTV RILVNPSIQP LLNASFGQTG LS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.116550.0callus| flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329852550.0
Expression AtlasQ10S83-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g03900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g03900
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000460.0AK100046.1 Oryza sativa Japonica Group cDNA clone:J013153P10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629744.10.0PREDICTED: protein NLP1
RefseqXP_015629745.10.0PREDICTED: protein NLP1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A0E0GGB00.0A0A0E0GGB0_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NP890.0A0A0E0NP89_ORYRU; Uncharacterized protein
STRINGLOC_Os03g03900.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2991697
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Schauser L,Wieloch W,Stougaard J
    Evolution of NIN-like proteins in Arabidopsis, rice, and Lotus japonicus.
    J. Mol. Evol., 2005. 60(2): p. 229-37
    [PMID:15785851]