PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g03850.1
Common NameLOC107280264
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 272aa    MW: 28967.5 Da    PI: 6.8437
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g03850.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.35.7e-20188221134
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                       C +C+tt+Tp+WR gpdg++tLCnaCG++yr  +
  LOC_Os03g03850.1 188 CGHCQTTETPQWRVGPDGPSTLCNACGIRYRIDH 221
                       9*****************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577168.55E-14180233No hitNo description
PROSITE profilePS5011412.4182220IPR000679Zinc finger, GATA-type
SMARTSM004011.2E-17182236IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.9E-15186219IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.81E-15187235No hitNo description
PfamPF003208.8E-18188221IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MRKPTPYVSL HDVVAFDFVD GDVPFDDLVD GEGLCCPDDP FEEVMRCLSA VDDPFLAAFK  60
LDCSPPTPAA DADVDSRSEE HMHADVGGGL DLQRAVGGGD EKAGTPSTVD DVPWLQASAV  120
ARKPRRAPAA VRKRVWSLVS PQLATAAAAA VDNSRDEVSS GGGGGGEGGE HCSRPAKRRR  180
KCGEEKRCGH CQTTETPQWR VGPDGPSTLC NACGIRYRID HLLPEYRPST SPGFGSDGYS  240
NRHRKVVKLR EKKRKKAMLA ATATALTSGP V*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1251255KKRKK
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ9SNJ1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g03850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g03850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0986930.0AC098693.3 Oryza sativa Japonica Group chromosome 3 clone OJ1004C08, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAP0006150.0AP000615.1 Oryza sativa Japonica Group genomic DNA, chromosome 3, clone:P0043E01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629442.10.0PREDICTED: GATA transcription factor 6-like
TrEMBLQ9SNJ10.0Q9SNJ1_ORYSJ; GATA zinc finger family protein
STRINGLOC_Os03g03850.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP127772434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.22e-18GATA transcription factor 11