PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g03760.1
Common NameOs03g0129800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 397aa    MW: 41807.7 Da    PI: 8.1819
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g03760.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1017.8e-322174255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      prlrWtp+LH++Fv+a+++LGG++kAtPk++l+lm+v gLt++hvkSHLQ+YR 
  LOC_Os03g03760.1 21 PRLRWTPDLHHCFVHAIHKLGGQDKATPKRVLQLMGVGGLTISHVKSHLQMYRN 74
                      8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.6531777IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-311777IPR009057Homeodomain-like
SuperFamilySSF466897.17E-161976IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-242174IPR006447Myb domain, plants
PfamPF002497.8E-102273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MVGGGRERNG GVRQYNRSKV PRLRWTPDLH HCFVHAIHKL GGQDKATPKR VLQLMGVGGL  60
TISHVKSHLQ MYRNMRNDLG MQGIQVQQVD QEHTYGGGVE VWTDMQQCDH DECDVPCCSC  120
HSPKPRKEPL LHLQLKSSGM NIDEPGTRAR IAAPNVRSCR DDAAASATET RRRRGGRPEE  180
VDDDANASTS PRISQLQLLR LRGHGIRESD MSPSTSLQCY YVRSQRTTTM PPGAAAAAAG  240
GDGGSQCYAA PRYSSSSKLK FLGFVVTSGP PPPRLPPPAA CCCGSDDNIP FQVGTFAPHR  300
VAPPTASCGG GGGGGRAEAR PSSSYRSVWF EPAAAAAASN NGVAPDGEHD DGCSLSLSLA  360
LDTGCAGAGG SLVSSTTSSS SGSRISLDLS LSTLDS*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154504980.0
Expression AtlasQ10S98-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g03760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g03760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0997390.0AC099739.2 Oryza sativa Japonica Group chromosome 3 clone OJ1528D07, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankAP0006150.0AP000615.1 Oryza sativa Japonica Group genomic DNA, chromosome 3, clone:P0043E01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629441.11e-80PREDICTED: probable transcription factor RL9
TrEMBLQ10S980.0Q10S98_ORYSJ; Myb-like DNA-binding domain, SHAQKYF class family protein, expressed
STRINGLOC_Os03g03760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
MonocotsOGMP76102950
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.14e-26G2-like family protein