PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g03540.1
Common NameOJ1015F07.11, Os03g0127200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 367aa    MW: 40400 Da    PI: 5.4804
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g03540.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.66.8e-5551341129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++     + e++ewyfFs +d+ky+tg+r+nrat +g+Wkatg+dk
  LOC_Os03g03540.1   5 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQEhcgIGYDEQSEWYFFSYKDRKYPTGTRTNRATMAGFWKATGRDK 96 
                       69****************************.9***************953432233667********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +v++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  LOC_Os03g03540.1  97 AVHD-KSRLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 134
                       ****.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-603154IPR003441NAC domain
PROSITE profilePS5100559.2075154IPR003441NAC domain
PfamPF023651.6E-286133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MESCVPPGFR FHPTDEELVG YYLRKKVASQ KIDLDVIRDI DLYRIEPWDL QEHCGIGYDE  60
QSEWYFFSYK DRKYPTGTRT NRATMAGFWK ATGRDKAVHD KSRLIGMRKT LVFYKGRAPN  120
GQKTDWIMHE YRLETDENAP PQEEGWVVCR AFKKRTAYPA RSMVETWDYS LHERNIMSAA  180
AAAAFADPSA AYAQMRRQHR SGRFKQEAEL DGAATALLHY SSHLAELPQL ESPSAAAAPL  240
QPNPSQLATA GEDDDCKGDN GGRRAKKARA AGDKVATTTD WRALDKFVAS QLSPGECGSM  300
EATAEAAAAA VAGVSSPLDH GDDDMAALLF LNSDERDEVD RWTGLLGSGA GASGVDGDLG  360
ICVFDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-50215812172Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.623990.0panicle| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8S5V6
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g03540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g03540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6340740.0JN634074.1 Oryza sativa Japonica Group secondary wall NAC transcription factor 5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630714.10.0PREDICTED: NAC domain-containing protein 37
SwissprotQ9SL411e-129NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA2XC010.0A2XC01_ORYSI; Putative uncharacterized protein
TrEMBLI1P7490.0I1P749_ORYGL; Uncharacterized protein
TrEMBLQ8S5V60.0Q8S5V6_ORYSJ; No apical meristem, putative, expressed
STRINGBGIOSGA011539-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g03540.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0019500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP36253768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36160.11e-119NAC domain containing protein 76
Publications ? help Back to Top
  1. Zhong R, et al.
    Transcriptional activation of secondary wall biosynthesis by rice and maize NAC and MYB transcription factors.
    Plant Cell Physiol., 2011. 52(10): p. 1856-71
    [PMID:21908441]