PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g03260.1
Common NameLOC4331452, Os03g0124000, OSNPB_030124000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 592aa    MW: 62754.1 Da    PI: 6.9511
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g03260.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36.3e-093443811954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  LOC_Os03g03260.1 344 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 381
                       564459******************************88 PP

2BELL87.71.2e-28207276372
              BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        elq+ k kL  +leeVd+rY++y+eq+++v++ Feavag  +a  Yt++A ++iSrhFr+L+d i+ q+
  LOC_Os03g03260.1 207 LELQRLKDKLYIMLEEVDRRYRRYCEQMRAVAGGFEAVAGERAAGAYTAVAARTISRHFRSLRDGIVAQL 276
                       58999**************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.6E-43138274IPR006563POX domain
PfamPF075265.9E-42144272IPR006563POX domain
PROSITE profilePS5007112.017322385IPR001356Homeobox domain
SMARTSM003894.7E-9325389IPR001356Homeobox domain
CDDcd000862.79E-12325386No hitNo description
SuperFamilySSF466891.58E-17326392IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.9E-28328391IPR009057Homeodomain-like
PfamPF059207.7E-18342381IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MAHDPNLGFA DYFSAADASA SSVTTLMPAM DEAAPELFGL QAGMELLGVR GLGMSMMPGA  60
AGKVAALVAD AGDDGGGGST MRFLSEQHQQ PSQAPLSLSL CRPDGVLHLG GAARPQHQLA  120
PAAPWMTHHD ASSSAPQVHG AWHLRSSRFL LPTQQLLQEF CSLPVDSTKR GNGAKAATQQ  180
EDGRGDGSSS SSASWTPSPQ IQAMEALELQ RLKDKLYIML EEVDRRYRRY CEQMRAVAGG  240
FEAVAGERAA GAYTAVAART ISRHFRSLRD GIVAQLQAAR KALGEKDVSA AGTTRGQTPR  300
LRVIDQCIRH HKSLQGVAAM DSHPWRPQRG LPDRAVTILR AWLFEHFLHP YPSDVDKHIL  360
ARQTGLSRSQ VSNWFINARV RLWKPMVEEM YVEEMKGQDG GDGSGGQGSL NPKPTCSHAS  420
EARGGQQLVV GDGDGGEQKP TRAQLRHDAG SLASVVNVDV AAGAGGVARL HQAENFGIMD  480
HLDFDAYDDS HHQQQHGGFG GVSLTLGLQQ HGSHGGGGVN IAFGAPGSAH GGAGFLYPGE  540
QMAPDAMHPG HGHHVVGGQF GVAMDGDAAS HAQERYRSLS AGFHLLRDLA G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A3e-17331389159Homeobox protein Meis2
5bng_B3e-17331389159Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.504420.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379908300.0
Expression AtlasQ10SF7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g03260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g03260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1212070.0AK121207.1 Oryza sativa Japonica Group cDNA clone:J023088C15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628192.10.0PREDICTED: homeobox protein BEL1 homolog
TrEMBLQ10SF70.0Q10SF7_ORYSJ; Associated with HOX family protein, expressed
STRINGLOC_Os03g03260.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
MonocotsOGMP38143764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.13e-76TALE family protein