PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g03164.2
Common NameHOS66, LOC4331449, Os03g0123500, OsJ_008895, OsJ_008896, OsJ_09228
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 315aa    MW: 34607.1 Da    PI: 6.0502
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g03164.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.31.1e-072642972154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp+++++++L +++gL+ +q+ +WF N+R +
  LOC_Os03g03164.2 264 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 297
                       469*****************************87 PP

2ELK25.43.3e-09218239122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELK +L++++++++ ++++E++
  LOC_Os03g03164.2 218 ELKIELKQGFKSRIEDVREEIL 239
                       9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.0E-165195IPR005540KNOX1
PfamPF037901.6E-145393IPR005540KNOX1
SMARTSM012568.8E-25106161IPR005541KNOX2
PfamPF037919.5E-19109160IPR005541KNOX2
PROSITE profilePS512139.132218238IPR005539ELK domain
PROSITE profilePS5007111.693238301IPR001356Homeobox domain
SMARTSM003894.9E-10240305IPR001356Homeobox domain
SuperFamilySSF466895.56E-16240304IPR009057Homeodomain-like
CDDcd000861.27E-11241302No hitNo description
Gene3DG3DSA:1.10.10.604.8E-25245304IPR009057Homeodomain-like
PfamPF059201.1E-17258297IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MQGGDHGGME MGVGSFTGGG GGGECSSSSA TAAAAAAAAA AAAAAEAEER QLLKGEIAVH  60
PLCEQLVAAH VGCLRVATPI DHLPLIDAQL AQSSGLLHSY AAHHRPFLSP HDKQELDSFL  120
AQYMMLLCSF REQLQQHVRV HAVEAVMACR EIEQSLQDLT GATLEEGTGA TMSEDEDETA  180
PMLEGPMDMG SDGHDLMGFG PLMPTDSERS LMERVRQELK IELKQGFKSR IEDVREEILR  240
KRRAGKLPGD TTTILKQWWQ QHSKWPYPTE DDKAKLVEET GLQLKQINNW FINQRKRNWH  300
NNSQTSTLKS KRKR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1294313RKRNWHNNSQTSTLKSKRKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41640.0flower| leaf| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO141491400.0
Expression AtlasQ94LW3-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo at 3 days after pollination (DAP). {ECO:0000269|PubMed:10095070}.
UniprotTISSUE SPECIFICITY: Isoform 1 is expressed in roots and flowers, and at lower levels in leaf blades and leaf sheaths. Isoform 2 is expressed in roots and flowers. {ECO:0000269|PubMed:12034492}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g03164.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g03164
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0618190.0AB061819.1 Oryza sativa Japonica Group HOS66 mRNA for KNOX family class 2 homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628919.10.0PREDICTED: homeobox protein knotted-1-like 3
SwissprotQ94LW30.0KNOS3_ORYSJ; Homeobox protein knotted-1-like 3
TrEMBLA0A0E0NP050.0A0A0E0NP05_ORYRU; Uncharacterized protein
TrEMBLI1P7140.0I1P714_ORYGL; Uncharacterized protein
STRINGLOC_Os03g03164.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0016000.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-138KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Ito Y,Eiguchi M,Kurata N
    Expression of novel homeobox genes in early embryogenesis in rice.
    Biochim. Biophys. Acta, 1999. 1444(3): p. 445-50
    [PMID:10095070]
  2. Ito Y,Hirochika H,Kurata N
    Organ-specific alternative transcripts of KNOX family class 2 homeobox genes of rice.
    Gene, 2002. 288(1-2): p. 41-7
    [PMID:12034492]
  3. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]