PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g03100.1
Common NameOJ1126B12.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 117aa    MW: 13279.6 Da    PI: 11.1997
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g03100.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.79.6e-31959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  LOC_Os03g03100.1  9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 59
                      79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.595161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.26E-29366IPR002100Transcription factor, MADS-box
CDDcd002658.38E-37359No hitNo description
PRINTSPR004041.3E-31323IPR002100Transcription factor, MADS-box
PfamPF003196.0E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MVRGKTQMKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSP RGKLYEFASA  60
RKIRPEKTAK TIFPRVAIEL PSKQSHYFHK EISCETGKVR NSENIGNLVL AFRRAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D3e-18360259Myocyte-specific enhancer factor 2A
3mu6_C3e-18360259Myocyte-specific enhancer factor 2A
3mu6_B3e-18360259Myocyte-specific enhancer factor 2A
3mu6_A3e-18360259Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO453859510.0
Expression AtlasQ8H8H1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g03100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g03100
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519150.0AY551915.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS210 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007134936.11e-35hypothetical protein PHAVU_010G088100g
RefseqXP_007134937.11e-35hypothetical protein PHAVU_010G088100g
RefseqXP_015630979.12e-35PREDICTED: MADS-box transcription factor 50
RefseqXP_015691001.12e-35PREDICTED: MADS-box transcription factor 50-like
RefseqXP_006649298.12e-35PREDICTED: MADS-box transcription factor 50-like
RefseqXP_015691000.12e-35PREDICTED: MADS-box transcription factor 50-like
SwissprotQ9XJ602e-37MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLA0A0D3FD599e-81A0A0D3FD59_9ORYZ; Uncharacterized protein
TrEMBLQ8H8H19e-81Q8H8H1_ORYSJ; Agamous-like MADS box protein AGL14, putative, expressed
STRINGLOC_Os03g03100.12e-80(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.14e-36AGAMOUS-like 20