PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g02800.1
Common NameLOC9270943, OJ1263H11.11, Os03g0119966, OsJ_09200, OSNPB_030119966, RIM1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 651aa    MW: 72833.4 Da    PI: 6.4741
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g02800.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.69.4e-5761331128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       lppGfrFhPtdeel+ +yLk+k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++
  LOC_Os03g02800.1   6 LPPGFRFHPTDEELIIYYLKRKINGRQIEL-EIIPEVDLYKCEPWDLPeKsFLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRK 97 
                       79****************************.99**************95334455777*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v s ++++vg+kktLv+y+grap+g++tdWvmheyrl
  LOC_Os03g02800.1  98 VNS-QRRAVGMKKTLVYYRGRAPHGSRTDWVMHEYRL 133
                       ***.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-644156IPR003441NAC domain
PROSITE profilePS5100561.5476156IPR003441NAC domain
PfamPF023651.5E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI IYYLKRKING RQIELEIIPE VDLYKCEPWD LPEKSFLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QRRAVGMKKT LVYYRGRAPH  120
GSRTDWVMHE YRLDERECET DTGLQDAYAL CRVFKKTAPG PKIIEHYGVV HHHVEQPQWM  180
TSSIDRSPTL DVSCDGRGDD FESSSFSFPT ETPMDSMHGG FGMQMSAPHE DGKWMQFLSE  240
DAFNATNPFL TNPVSANFSC LPSKVDVALE CARLQHRLTL PPLEVEDFPQ DVSLDTKIGI  300
LRSNPNEVDI LQEFLSVATA SQELINGSTS SYPEMWLGAS TSSASYVNEL SSLVEMGGVG  360
TSNHHESARL QVEIADMEVF KDEKKRVENL RGVKLVNNDL GEIVVEGDES NPTEDIIAQY  420
PIKVTADNSG EAGHRMTDPT DVGGIDTAPI FSQSQPDDFA AGFDDVNPNA SFDLYEKVDV  480
NHRLFVSRVA AAKTFFHRIE PSKKVSFHSN PAATAVSKAT EKFHFPVTTK VSGRVSIFSK  540
FKALIRDKFL MMRPSHSYQR LGSKETTVNE LLQIVSLLLA PKQINGCPTE QELVKKKAKE  600
VMKPGWGREG SNKLWLPLSK GKGISSMFLS GKWTFLTSAL AISTPAECDH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B8e-56116212171NAC domain-containing protein 19
4dul_A8e-56116212171NAC domain-containing protein 19
1ut7_B8e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_A8e-56116212171NO APICAL MERISTEM PROTEIN
1ut4_B8e-56116212171NO APICAL MERISTEM PROTEIN
1ut4_A8e-56116212171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.831550.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8H045
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g02800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g02800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2658210.0AB265821.1 Oryza sativa Japonica Group RIM1 mRNA for NAC protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628521.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628520.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628519.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628518.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628517.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628516.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628515.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628514.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
RefseqXP_015628513.10.0PREDICTED: NAC domain-containing protein 45 isoform X1
TrEMBLA0A0E0NNW90.0A0A0E0NNW9_ORYRU; Uncharacterized protein
TrEMBLQ8H0450.0Q8H045_ORYSJ; NAC protein
STRINGLOC_Os03g02800.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP87171015
MonocotsOGMP66243651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-128NAC domain containing protein 28
Publications ? help Back to Top
  1. Yoshii M, et al.
    Disruption of a novel gene for a NAC-domain protein in rice confers resistance to Rice dwarf virus.
    Plant J., 2009. 57(4): p. 615-25
    [PMID:18980655]