PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os03g02240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 726aa    MW: 76494.9 Da    PI: 7.1062
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os03g02240.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix98.94.4e-3161145187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW++qe+laL+++r+em+ ++r+++lk+plWeevs+k++e g++rs+k+C+ek+en+ k+yk++k+g+ +r  ++ +t+++f++lea
  LOC_Os03g02240.1  61 RWPRQETLALLKIRSEMDAAFREAALKGPLWEEVSRKLAEMGYKRSAKKCREKFENVDKYYKRTKDGRAGR--GDGKTYRFFTELEA 145
                       8********************************************************************97..77778******985 PP

2trihelix107.96.9e-34418503187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k ev+aLi++r+e+e+r++++  k+plWe++s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr +e+s+tcpy++ql+a
  LOC_Os03g02240.1 418 RWPKAEVHALIQLRTELETRYQDSGPKGPLWEDISAGMRRLGYSRSSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYYHQLDA 503
                       8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.004758120IPR001005SANT/Myb domain
PROSITE profilePS500906.82960118IPR017877Myb-like domain
PfamPF138371.4E-2160146No hitNo description
CDDcd122031.40E-2860125No hitNo description
PROSITE profilePS500907.201411475IPR017877Myb-like domain
SMARTSM007170.0051415477IPR001005SANT/Myb domain
PfamPF138371.9E-23417504No hitNo description
CDDcd122034.12E-29418482No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MPPFSAAGGE GAPSPISSRP PPPEQAAAAA AEEQLNGSSL EHDGVLGGEE GDRGGSSAGN  60
RWPRQETLAL LKIRSEMDAA FREAALKGPL WEEVSRKLAE MGYKRSAKKC REKFENVDKY  120
YKRTKDGRAG RGDGKTYRFF TELEALHGAA AATARPPPVS LAPAPVAVAP PATPAGLSAL  180
RVHASPPPPP VKQHAAPPPP VMDVAACVMT MDDVSFSSGS DTEETAEEGG KRKRRGGGGI  240
GGGGGGGKAM RMFEGLMRQV MERQEAMQQR LLEAIERRDQ ERMIREEAWR RQEVARLARE  300
QDALAQERAI AASRDAAVIS FIQRVTGQSI AAVPPPPLQP TPVASAAPPP PPQHHHQQTP  360
PPIQVQPHHI MPMTPQPQLQ PPQPQSKEAN TVVRAAPPPQ EQHDTAASGG GGGASSSRWP  420
KAEVHALIQL RTELETRYQD SGPKGPLWED ISAGMRRLGY SRSSKRCKEK WENINKYFKK  480
VKESNKKRPE DSKTCPYYHQ LDALYRTKAA NAAAAASASP APATTTVLAP VPLSQTPPHV  540
DHGGSNGNGN GWASANNGGG GSSSGGMQTK ASNNGTATAG GLPVVSVAGG NGNGNGVAAT  600
TDNKGSKQVP VAKETAGQRQ PQPLAMNHNY GNDRMADDMD SDSMDDDDDD DEFDDDENDD  660
DIGGGKMQVQ YETSSHFQRP QLQNQNVVVG RPNASGGGGG GAPTTPAGPP PPAATSGTSF  720
LACVQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1234247RGGGGIGGGGGGGK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.395760.0flower| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976002280.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os03g02240.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs03g02240
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2418000.0AK241800.1 Oryza sativa Japonica Group cDNA, clone: J065208I24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628078.10.0PREDICTED: trihelix transcription factor GTL1
TrEMBLA0A0E0NNQ00.0A0A0E0NNQ0_ORYRU; Uncharacterized protein
STRINGLOC_Os03g02240.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.19e-48Trihelix family protein