PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g58670.1
Common NameLOC4331270, OJ1282_E10.14, Os02g0833600, OsJ_09015, OSNPB_020833600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 143aa    MW: 15220.2 Da    PI: 9.7924
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g58670.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.22.7e-1667127161
                       XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                       e+e ++++r++kNRe+A rsR+RK+a+++eLe++v  L +eN +Lk   ++lk e+a+l +
  LOC_Os02g58670.1  67 EEEERKTIRMMKNRESALRSRARKRAYVQELEKEVRRLVNENLKLKRHCKQLKTEMAALIQ 127
                       678899************************************************9998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.1E-1765128No hitNo description
PRINTSPR000411.7E-56682IPR001630cAMP response element binding (CREB) protein
PfamPF001709.5E-1467127IPR004827Basic-leucine zipper domain
SMARTSM003384.7E-1467131IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.50769125IPR004827Basic-leucine zipper domain
CDDcd147076.10E-1571125No hitNo description
SuperFamilySSF579591.24E-1271128No hitNo description
PRINTSPR000411.7E-584104IPR001630cAMP response element binding (CREB) protein
PRINTSPR000411.7E-5104121IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MAEQLGGVGS PQLSLSSCSS FLSISSAGTS AADGAPHLSL GVGGAEELDL LLQVGIGGGG  60
GGGGDEEEEE RKTIRMMKNR ESALRSRARK RAYVQELEKE VRRLVNENLK LKRHCKQLKT  120
EMAALIQQPT NKQSSHRRSS ST*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.183540.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6ESB3
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g58670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g58670
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0610860.0AK061086.1 Oryza sativa Japonica Group cDNA clone:006-206-G05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623884.11e-97PREDICTED: protein FD
SwissprotQ84JK21e-15FD_ARATH; Protein FD
TrEMBLA0A0D3FCJ01e-97A0A0D3FCJ0_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GFF81e-97A0A0E0GFF8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NNE11e-97A0A0E0NNE1_ORYRU; Uncharacterized protein
TrEMBLA2XBE01e-97A2XBE0_ORYSI; Putative uncharacterized protein
TrEMBLI1P5X31e-97I1P5X3_ORYGL; Uncharacterized protein
TrEMBLQ6ESB31e-97Q6ESB3_ORYSJ; Os02g0833600 protein
STRINGBGIOSGA005293-PA3e-97(Oryza sativa Indica Group)
STRINGLOC_Os02g58670.13e-97(Oryza sativa Japonica Group)
STRINGORGLA02G0337900.13e-97(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9528513
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.12e-15bZIP family protein