PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g57650.1
Common NameLOC4331187, OJ1119_A01.21, Os02g0822400, OsJ_08923, OSNPB_020822400, P0474F11.36
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 633aa    MW: 69559.6 Da    PI: 4.3167
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g57650.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.82.2e-49161521128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkya.........tgkrknratksgy 82 
                       l+pGfrFhPtdeelv++yL++++ g++l++ ++i+evd+y++ePwdLp  +++++++ +wyfF++ d+k +          g+r+nrat +gy
  LOC_Os02g57650.1  16 LAPGFRFHPTDEELVSYYLRRRILGRRLRI-DAIAEVDLYRLEPWDLPslSRIRSRDAQWYFFARLDRKVTgagaggrggPGNRTNRATPRGY 107
                       579***************************.99***************5448999999***********99777777665567********** PP

               NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       Wk+tgkd++v++ +g+lvg+kktLvf++grapkg++t+Wvmheyrl
  LOC_Os02g57650.1 108 WKTTGKDRDVHH-RGKLVGMKKTLVFHSGRAPKGQRTNWVMHEYRL 152
                       ************.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-5511170IPR003441NAC domain
PROSITE profilePS5100555.4816170IPR003441NAC domain
PfamPF023654.6E-2718152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MSQSPPDSSS AAAVPLAPGF RFHPTDEELV SYYLRRRILG RRLRIDAIAE VDLYRLEPWD  60
LPSLSRIRSR DAQWYFFARL DRKVTGAGAG GRGGPGNRTN RATPRGYWKT TGKDRDVHHR  120
GKLVGMKKTL VFHSGRAPKG QRTNWVMHEY RLLDADGTQD LHVVCRIFQK NGSGPQNGAQ  180
YGAPYLEEDW EEEDDAIENM PASGAFAEMA AVTDTADEST EEDGNFSLKT NDEPLQTQEY  240
QPEITPVKAQ GSNEETNGGG YSCDVFSLDE ILQEPENVCK NEEQNAIDDK FTIAELSGYP  300
RQDDGYVGEN GPVNWIDPSN GDNTNWPLRA YSTQNHVNGT LSADGFFDTV NGTNSYSGPS  360
DNQNLYLQDD GLTSSHQVGD NMPFYDASSN HKWVDGKDDY LNLNDLLYPP AENQPLFDAG  420
DDLMAYFDAT EDDFKFDIMG TEDSNSQLPD MSNFVQKDDN NNKFTLDGIS NTALYGASSS  480
GSHGNMYPDT AVPDMPMDDT VDKSFGKRLA SMLGSIPAPP AMASEFPPST GKSVVPLSAV  540
NPSSSIRVTA GIIQLGGITF TGSTEHLQKN GDFNLLLSFT VEGDVSTKSI GFEPDTQMST  600
TPMVLRSGMY LFFVSAMILM LSYKVGLCIY SR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-4371526140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.811640.0callus| flower| leaf| panicle| root| seed| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329873820.0
Expression AtlasQ6K6Z3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g57650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g57650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1021730.0AK102173.1 Oryza sativa Japonica Group cDNA clone:J033086I18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624689.10.0PREDICTED: NAC domain-containing protein 78 isoform X1
TrEMBLQ6K6Z30.0Q6K6Z3_ORYSJ; Os02g0822400 protein
STRINGLOC_Os02g57650.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1462444
MonocotsOGMP129312833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-59NAC domain containing protein 2
Publications ? help Back to Top
  1. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]