PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g56250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 419aa    MW: 43831.3 Da    PI: 5.626
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g56250.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.15.2e-18335368134
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                       C++C+  kTp+WR gp g+ktLCnaCG++y++ +
  LOC_Os02g56250.1 335 CTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGR 368
                       *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.19E-14328391No hitNo description
SMARTSM004011.6E-15329379IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.082329365IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.4E-14333366IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.35E-14334391No hitNo description
PROSITE patternPS003440335360IPR000679Zinc finger, GATA-type
PfamPF003201.2E-15335368IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MAGVGFVEDM LREQSLLEAT CGDLFDHIDD LLDFPKEESA ADVLLLDAPA PGSPLSSRII  60
GGHATMAAAP PPPPQMMALP PPPAPAKDDA SALFDAAGAL GAEVFDRKDA HIGPCDELDM  120
DMAQLEWLSG LFDDGTIPHE PSFPGVNCAA PIKASALTAN AGVVLPDKAE EALFRSSSPI  180
SVLEHSGFNV ATNGGSSSSS SSSASSSSES FSGSGRAWSA PVSPRPEPPV LVIPARARSK  240
RSRPSAFPAV RGAPAATETT ILVPTPMYSS TSSHSDPESI AESNPHPPPM KKKKKAKKPA  300
APAAASDAEA DADAADADYE EGGALALPPG TVRRCTHCQI EKTPQWRAGP LGPKTLCNAC  360
GVRYKSGRLF PEYRPAASPT FMPSIHSNSH KKVVEMRQKA TRTADPSCDL LQYIRRRD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.162480.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166382080.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g56250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g56250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8289660.0CT828966.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA222D18, full insert sequence.
GenBankCT8289650.0CT828965.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA219J10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626108.10.0PREDICTED: GATA transcription factor 11
RefseqXP_015626107.10.0PREDICTED: GATA transcription factor 11
TrEMBLA0A0D9YZV50.0A0A0D9YZV5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0CST70.0A0A0E0CST7_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GEF80.0A0A0E0GEF8_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NMG80.0A0A0E0NMG8_ORYRU; Uncharacterized protein
TrEMBLA2XAR70.0A2XAR7_ORYSI; Putative uncharacterized protein
TrEMBLQ948G40.0Q948G4_ORYSA; Putative GATA-1 zinc finger protein
STRINGBGIOSGA009241-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os02g56250.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
MonocotsOGMP51693451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.21e-36GATA family protein