PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g55320.1
Common NameLOC4331008, OJ1004_E04.14, OJ1695_H09.29, ORR3, Os02g0796500, OsJ_08721, RR23
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARR-B
Protein Properties Length: 689aa    MW: 74384 Da    PI: 6.9181
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g55320.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.12e-28214267155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+ Lt+e+v+SHLQkYRl
  LOC_Os02g55320.1 214 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKRILELMNVEKLTRENVASHLQKYRL 267
                       79*******************.********************************8 PP

2Response_reg76.59.8e-26261341109
                       EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHH CS
      Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealk 91 
                       vl vdD+p+ +++l+++l + +y +v+++ ++  al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++ +ge +++l+ + 
  LOC_Os02g55320.1  26 VLAVDDDPVCLKVLETLLLRCQY-HVTTTNQAAIALKMLRENRdmFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSVNGETKTVLKGIT 116
                       799********************.***************99999********************87754.558******************** PP

                       TTESEEEESS--HHHHHH CS
      Response_reg  92 aGakdflsKpfdpeelvk 109
                        Ga d+l Kp+ +eel++
  LOC_Os02g55320.1 117 HGACDYLLKPVRIEELRN 134
                       ****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.1E-2091688IPR017053Response regulator B-type, plant
SuperFamilySSF521722.85E-3423150IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.5E-4023157No hitNo description
SMARTSM004483.6E-3024136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.41625140IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.6E-2326135IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.63E-2627140No hitNo description
PROSITE profilePS5129412.56211270IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-30212272IPR009057Homeodomain-like
SuperFamilySSF466899.14E-20212271IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-25214267IPR006447Myb domain, plants
PfamPF002491.3E-6216266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MRAAEERKGV VPAARRRDQF PVGMRVLAVD DDPVCLKVLE TLLLRCQYHV TTTNQAAIAL  60
KMLRENRDMF DLVISDVHMP DMDGFKLLEL VGLEMDLPVI MLSVNGETKT VLKGITHGAC  120
DYLLKPVRIE ELRNIWQHVI RRKFSTRDRA NLDFYEECNK PPNADSDHVH GHVTCGSPDQ  180
SGRPSKKRKE YCSEEEDEGE VNTQDIDDPS APKKPRVVWS VELHRKFVAA VNQLGIDKAV  240
PKRILELMNV EKLTRENVAS HLQKYRLYLK RLSAVASQQV SIVAALGGRD PFLHMGGFEG  300
LQGYQAFTSS AALSSFTPHG LLNSPRNNPA ALGTQGVPAS KSIQTMSGSH TLSHSINDAN  360
KYHLSLPGNQ KGNLGQGLAT SLGQTQMQQK WIHEETDDLS TILSGNGLSN GMSGTLQSVT  420
SSPLLPQELA ECTQAKIVSQ PSIRTSSVSS EHIEGAVGVS SGLLESRVSQ QSTIPLSGFS  480
ANGLLIHGSF NNTCANKLGG TSSSCAPARS SNDLMVARDT KGGASSFGGA MLLPPDTEQK  540
YLNFGGGNGL KQKFDDRTAD SLFDLKFVWS SVPSSQLASN IGAHHAMSQR WNNSSSNSSN  600
IGARMIGQAT SSGSTVIPQM KTDFLVSGDM AMPKNASDLS IPKLQSELSS SSCSFDGLLN  660
SIVKVEKDDV TFSDDLGCGD FYSLGACI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-25210273164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.52430.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329752940.0
Expression AtlasQ6K8X6-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g55320.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Dwarf, narrow leaf, low tillering, lesion mimic, late heading and low fertility phenotypes. {ECO:0000269|PubMed:16891544}.
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g55320
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0995810.0AK099581.1 Oryza sativa Japonica Group cDNA clone:J013040N16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625496.10.0PREDICTED: two-component response regulator ORR23
SwissprotQ6K8X60.0ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLI1P5610.0I1P561_ORYGL; Uncharacterized protein
STRINGLOC_Os02g55320.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP29217120
MonocotsOGMP18563894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-105response regulator 12
Publications ? help Back to Top
  1. Pareek A, et al.
    Whole-genome analysis of Oryza sativa reveals similar architecture of two-component signaling machinery with Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 380-97
    [PMID:16891544]
  2. Ito Y,Kurata N
    Identification and characterization of cytokinin-signalling gene families in rice.
    Gene, 2006. 382: p. 57-65
    [PMID:16919402]
  3. Schaller GE, et al.
    Nomenclature for two-component signaling elements of rice.
    Plant Physiol., 2007. 143(2): p. 555-7
    [PMID:17284581]
  4. Tsai YC, et al.
    Characterization of genes involved in cytokinin signaling and metabolism from rice.
    Plant Physiol., 2012. 158(4): p. 1666-84
    [PMID:22383541]