PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g54520.1
Common NameOJ1316_E06.12, Os02g0786300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 564aa    MW: 58761.4 Da    PI: 5.8392
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g54520.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-15212260148
                       TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+W++eEd +l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
  LOC_Os02g54520.1 212 KGPWSPEEDAKLKAYIEENGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 260
                       79*********************************************97 PP

2Myb_DNA-binding38.13.7e-12267309246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T+eE+ ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  LOC_Os02g54520.1 267 GDFTEEEEHIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 309
                       789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.093207260IPR017930Myb domain
SuperFamilySSF466891.05E-25209307IPR009057Homeodomain-like
SMARTSM007173.7E-12211262IPR001005SANT/Myb domain
PfamPF002491.5E-14212260IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-23213267IPR009057Homeodomain-like
CDDcd001677.93E-9214260No hitNo description
PROSITE profilePS5129421.924261315IPR017930Myb domain
SMARTSM007172.9E-10265313IPR001005SANT/Myb domain
PfamPF002498.0E-11267309IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-22268315IPR009057Homeodomain-like
CDDcd001671.18E-6269309No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MAAAAARDDD LGNDDLDDDR SNPRRQSGGR TAGPIRQGLH GDIGLQMTAA MAGDDANDGG  60
HGWRRWLSTA AVAAVLLSLG DGGDDDKATE GIRGSSAGMY TDKRSVSEDT HLYPSTKPTI  120
KPARPQPQMH PLTAAAKHAI TIPPPPPPAA AASYTSSPSS GTSDPSVLDL SSAEIDDDGD  180
GDDDRAEQQE IKNSKELVMG RAPCCDKASV KKGPWSPEED AKLKAYIEEN GTGGNWIALP  240
QKIGLKRCGK SCRLRWLNYL RPNIKHGDFT EEEEHIICSL YISIGSRWSI IAAQLPGRTD  300
NDIKNYWNTK LKKKLLGKRA PSRRARANQD HCGLAGSAAA AMCGGVGTAA AAAPPHQALS  360
SSALERIQLH MRLQGLYNSA FGCTTTSSNG GGVGVAPPQW PKLEALLPSR PLPAVQPTDA  420
VVATVQHPHH LVVGGHTLAT AAAAAATTSE AFQAAEHLDP AAATGSNYMP GVAGVEMTSS  480
SSMAGGGGFV AGYGLHDELY DFLFKCESIG GAQGGIIPSS LPELQCPDGS AIIGADEKFS  540
TWTSSSCDYG SGGAGDYVLG YDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-242123157108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6K9I8
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g54520.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g54520
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0040570.0AP004057.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1316_E06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624187.10.0PREDICTED: uncharacterized protein LOC4330950
TrEMBLQ6K9I80.0Q6K9I8_ORYSJ; Os02g0786300 protein
STRINGLOC_Os02g54520.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1206146
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-79myb domain protein 36