PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g53690.1
Common NameGRF1, LOC4330903, OJ1534_E09.5, Os02g0776900, OsJ_08584, OSJNBb0013K01.39
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 398aa    MW: 43565.4 Da    PI: 7.5975
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g53690.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.99.7e-2590133144
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                       d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  LOC_Os02g53690.1  90 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 133
                       79***************************************998 PP

2QLQ59.69e-211853237
               QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                      +FTa+Q+q+L++Q+l+yKy+a++ P+P++L++++++
  LOC_Os02g53690.1 18 PFTASQWQELEHQALIYKYMASGTPIPSDLILPLRR 53
                      9********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.4E-111753IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.8011853IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.4E-151851IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57390134IPR014977WRC domain
PfamPF088792.1E-2091133IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MMMMSGRPSG GAGGGRYPFT ASQWQELEHQ ALIYKYMASG TPIPSDLILP LRRSFLLDSA  60
LATSPSLAFP PQPSLGWGCF GMGFGRKAED PEPGRCRRTD GKKWRCSKEA YPDSKYCEKH  120
MHRGKNRSRK PVEMSLATPP PPSSSATSAA SNTSAGVAPT TTTTSSPAPS YSRPAPHDAA  180
PYQALYGGPY AAATARTPAA AAYHAQVSPF HLQLDTTHPH PPPSYYSMDH KEYAYGHATK  240
EVHGEHAFFS DGTEREHHHA AAGHGQWQFK QLGMEPKQST TPLFPGAGYG HTAASPYAID  300
LSKEDDDEKE RRQQQQQQQQ QHCFLLGADL RLEKPAGHDH AAAAQKPLRH FFDEWPHEKN  360
SKGSWMGLEG ETQLSMSIPM AANDLPITTT SRYHNDD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.23470.0callus| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO65731480.0
Expression AtlasQ6AWY8-
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g53690.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g53690
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2018950.0AF201895.1 Oryza sativa growth-regulating factor 1 (GRF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624121.10.0PREDICTED: growth-regulating factor 1
SwissprotQ6AWY80.0GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLI1P4T30.0I1P4T3_ORYGL; Uncharacterized protein
STRINGLOC_Os02g53690.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-51growth-regulating factor 5
Publications ? help Back to Top
  1. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]