PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g53620.1
Common NameLOC9270863, Os02g0776400, OSNPB_020776400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 271aa    MW: 29450.8 Da    PI: 10.811
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g53620.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1041.3e-3297153158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       d p+YVN+KQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+Rg+gGrF
  LOC_Os02g53620.1  97 DGPIYVNPKQYHGILRRRQLRAKLEAQNKL-VKTRKPYLHESRHRHAMKRARGTGGRF 153
                       57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-3795156IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.73596156IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-2499121IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.1E-2899153IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-24130153IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MLLPSSSSYS YASKGDSFRR TVDGPMRSTL TFDNNHSVVP SQNIDYGQPM ACISYPYNDS  60
GSGVWASYSS RSVFHPQIVG GGTSPRVPLP SLEIADDGPI YVNPKQYHGI LRRRQLRAKL  120
EAQNKLVKTR KPYLHESRHR HAMKRARGTG GRFLNTKQLQ LQQQSHTTST KTTTDSQNSS  180
GSVHLRLGGG AIGDQTPFPF KAMDSQANIK RAAASASTFT VTSAAQKDDA FFDRHGHHLS  240
SFSGHFGQAS AQGGVGSMHN GSQQRVPAMR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-2099158463NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137146RHRHAMKRAR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.766690.0callus| flower
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0N7KG67
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g53620.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g53620
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3185740.0AK318574.1 Oryza sativa Japonica Group cDNA, clone: J090045B17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623433.10.0PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
RefseqXP_015623432.10.0PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
TrEMBLA0A0N7KG670.0A0A0N7KG67_ORYSJ; Os02g0776400 protein
STRINGLOC_Os02g53620.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1463244
MonocotsOGMP132762833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.13e-31nuclear factor Y, subunit A5