PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g52780.1
Common NameLOC4330838, OJ1004_A11.20, Os02g0766700, OSNPB_020766700, P0539D10.39
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 358aa    MW: 38099.5 Da    PI: 9.7632
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g52780.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.22.3e-15277325553
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                       +r+rr++kNRe+A rsRqRK+a++ eLe +v++L++ N++L+k+ +e+ 
  LOC_Os02g52780.1 277 RRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNDELQKKQDEML 325
                       79***************************************98876643 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-14273338IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.197275327IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.6E-15277328No hitNo description
PfamPF001702.6E-13277327IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.8E-11277327No hitNo description
CDDcd147072.31E-24277329No hitNo description
PROSITE patternPS000360280295IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MDFPGGSGRQ QQLPPMTPLP LARQGSVYSL TFDEFQSTLG GVGKDFGSMN MDELLRSIWT  60
AEESHAVGAA TTTTATTASV AAAEHAAVGA PPVQRQGSLT LPRTLSQKTV DEVWRDMMCF  120
GGGGASTAPA AAEPPPPAHR QQTLGEITLE EFLVRAGVVR EDMSVPPVPP APTPTAAAVP  180
PPPPPQQQTP MLFGQSNVFP PMVPPLSLGN GLVSGAVGHG GGGAASLVSP VRPVSSNGFG  240
KMEGGDLSSL SPSPVPYVFK GGLRGRKAPG IEKVVERRQR RMIKNRESAA RSRQRKQAYM  300
MELEAEVAKL KELNDELQKK QDEMLEQQKN EVLERMSRQV GPTAKRICLR RTLTGPW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.117810.0callus| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329820850.0
Expression AtlasQ6Z312-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g52780.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g52780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0720620.0AK072062.1 Oryza sativa Japonica Group cDNA clone:J013109E06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625853.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
SwissprotQ6ZDF31e-67TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLQ6Z3120.0Q6Z312_ORYSJ; Os02g0766700 protein
STRINGLOC_Os02g52780.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5401580
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.25e-41ABRE binding factor 4