PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g52340.1
Common NameLOC4330805, MADS22, OJ1175_B01.24, Os02g0761000, OsJ_08471, RMD1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 229aa    MW: 25592.6 Da    PI: 5.4128
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g52340.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF862.2e-27959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krie+   rqvtfskRr g++KKAeELSvLCda+va+i+fsstgkl  ++s
  LOC_Os02g52340.1  9 KRIESAAARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLSHFAS 59
                      79*********************************************9986 PP

2K-box56.71.1e-19901711899
             K-box  18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                       + ++a L++++ +    +R++ Ge+Le Ls+ eLqqLe++Le +l ++  +K++ ++eqi+elq+k  +l een++Lr+++ 
  LOC_Os02g52340.1  90 HSKYAHLNEQLAEASLRLRQMRGEELEGLSIDELQQLEKNLEAGLHRVMLTKDQQFMEQISELQRKSSQLAEENMQLRNQVS 171
                       334555555555555889************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.455161IPR002100Transcription factor, MADS-box
CDDcd002652.85E-39275No hitNo description
SuperFamilySSF554553.4E-30374IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-24323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.08286176IPR002487Transcription factor, K-box
PfamPF014861.4E-1792170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020104anatomyleaf sheath
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MARERREIKR IESAAARQVT FSKRRRGLFK KAEELSVLCD ADVALIVFSS TGKLSHFASS  60
SMNEIIDKYN THSNNLGKAE QPSLDLNLEH SKYAHLNEQL AEASLRLRQM RGEELEGLSI  120
DELQQLEKNL EAGLHRVMLT KDQQFMEQIS ELQRKSSQLA EENMQLRNQV SQISPAEKQV  180
VDTENFVTEG QSSESVMTAL HSGSSQSQDN DDGSDVSLKL GLPCGAWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-18173173Myocyte-specific enhancer factor 2B
1tqe_R4e-18173173Myocyte-specific enhancer factor 2B
1tqe_Q4e-18173173Myocyte-specific enhancer factor 2B
1tqe_P4e-18173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41710.0callus| flower| leaf| panicle| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329801450.0
Expression AtlasQ9XJ66-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the L1 cell layer of the embryo 2 days after pollination. {ECO:0000269|PubMed:15682279}.
UniprotTISSUE SPECIFICITY: Expressed in palea and stamen primordia. {ECO:0000269|PubMed:15682279}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. May be required for spikelet (rice flower) development. {ECO:0000269|PubMed:15682279}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g52340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9XJ66
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g52340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7509380.0FJ750938.1 Oryza sativa clone KCS016G07 MADS-box transcription factor 22 mRNA, complete cds.
GenBankAB1079570.0AB107957.1 Oryza sativa Japonica Group RMD1 mRNA for MADS domain protein, complete cds.
GenBankAB0033220.0AB003322.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:C50086.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624915.11e-167PREDICTED: MADS-box transcription factor 22
SwissprotQ9XJ661e-169MAD22_ORYSJ; MADS-box transcription factor 22
TrEMBLD3U2H01e-167D3U2H0_ORYSA; MADS-box transcription factor 22
STRINGLOC_Os02g52340.11e-166(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP12213697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.19e-75MIKC_MADS family protein
Publications ? help Back to Top
  1. Shinozuka Y, et al.
    Isolation and characterization of rice MADS box gene homologues and their RFLP mapping.
    DNA Res., 1999. 6(2): p. 123-9
    [PMID:10382970]
  2. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  3. Sentoku N,Kato H,Kitano H,Imai R
    OsMADS22, an STMADS11-like MADS-box gene of rice, is expressed in non-vegetative tissues and its ectopic expression induces spikelet meristem indeterminacy.
    Mol. Genet. Genomics, 2005. 273(1): p. 1-9
    [PMID:15682279]