PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g51799.1
Common NameLOC4330764, OsJ_08424, P0627E03.13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 378aa    MW: 40296.6 Da    PI: 6.7108
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g51799.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.3e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WTteEde+l +++++ G g+W++ ++  g++R++k+c++rw +yl
  LOC_Os02g51799.1 14 KGPWTTEEDEKLMEYIQKNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding51.52.3e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T  E + ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  LOC_Os02g51799.1  67 RGKFTSAEKDTILQLHAVLGNK-WSAIAKHLP-GRTDNEIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.901961IPR017930Myb domain
SuperFamilySSF466891.42E-3111108IPR009057Homeodomain-like
SMARTSM007176.5E-141363IPR001005SANT/Myb domain
PfamPF002499.8E-171461IPR001005SANT/Myb domain
CDDcd001678.06E-111661No hitNo description
PROSITE profilePS5129425.32962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-2765117IPR009057Homeodomain-like
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002494.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.66E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTTE EDEKLMEYIQ KNGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF TSAEKDTILQ LHAVLGNKWS AIAKHLPGRT DNEIKNYWNT HLKKDLIQKG  120
IDPTTHRPRT DFFAALPQLI ALANLRQLVG QLPWDDPAAA AAGLQQAEAA QAAKFGQYLH  180
LQALLQPPPP SAATSPRSGC IGGAAAAMPG GDMEQMGAGL LSPPAMSSAA LSPMSTSSLS  240
PLPSPMSSTA LSPLPPSSFF GNGGQGSFLA GQLPNIQMHG SSLFDQSAAI INDANHNQDY  300
AASTGEREII NGATKTTTTT LLPEGSLPPL ADYPTISNLG DVYSTPSCDG NITEFPLLPD  360
ALFDELMRDY VSPSSSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.703540.0leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2975999380.0
Expression AtlasQ6Z699-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g51799.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g51799
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0050120.0AP005012.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0627E03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623220.10.0PREDICTED: myb-related protein Zm38
TrEMBLA0A0E0GCY10.0A0A0E0GCY1_ORYNI; Uncharacterized protein
TrEMBLI1P4D90.0I1P4D9_ORYGL; Uncharacterized protein
TrEMBLQ6Z6990.0Q6Z699_ORYSJ; Putative P-type R2R3 Myb protein
STRINGLOC_Os02g51799.10.0(Oryza sativa Japonica Group)
STRINGORGLA02G0284500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-90myb domain protein 93