PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g51090.1
Common NameLOC107276758, OJ1118_G04.12, OJ1734_E02.39, Os02g0744950, OsJ_08362, OSNPB_020744950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 233aa    MW: 27394.9 Da    PI: 5.638
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g51090.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.41.1e-26113163252
            RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ek++++e +s+yF lpik+AA+eL+v+lT+LKr+CR +GI+RWPhRk+ksl
  LOC_Os02g51090.1 113 EKTLTFELVSQYFCLPIKQAAQELNVGLTLLKRRCRVLGIPRWPHRKVKSL 163
                       799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.3695184IPR003035RWP-RK domain
PfamPF020423.8E-22115163IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEKWRFYGGH QFQSYSFHEE ENLFQDWSLD YLLLGEDEPF FTHHFSTSVH SNFVQDELYT  60
LFDGDILSIW GDMKEDAYHR SDKDGGEKEE KLDHEKAMEL QLQRLPSGRQ SGEKTLTFEL  120
VSQYFCLPIK QAAQELNVGL TLLKRRCRVL GIPRWPHRKV KSLETIIKNV QELGMETGQD  180
EDNTRNAVEM LQQTKKLIEQ SPDAKLDDWT KMLRQACFKE NYKRRRLLAI EG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222226KRRRL
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6Z2T5
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g51090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g51090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0052970.0AP005297.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1734_E02.
GenBankAP0041140.0AP004114.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1118_G04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627117.11e-174PREDICTED: protein RKD1-like
RefseqXP_015627116.11e-174PREDICTED: protein RKD1-like
RefseqXP_015627115.11e-174PREDICTED: protein RKD1-like
RefseqXP_015627114.11e-174PREDICTED: protein RKD1-like
RefseqXP_015627113.11e-174PREDICTED: protein RKD1-like
SwissprotQ9M9U91e-41RKD1_ARATH; Protein RKD1
TrEMBLQ6Z2T51e-174Q6Z2T5_ORYSJ; Os02g0744950 protein
STRINGLOC_Os02g51090.11e-173(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5671777
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.18e-43RWP-RK domain-containing protein