PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g49986.1
Common NameLOC4330632, Os02g0732600, OsJ_08275, OSNPB_020732600, P0643A10.25
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 256aa    MW: 27759.3 Da    PI: 5.0253
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g49986.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-141461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed++lv      G  +W+++++  g+ R++k+c++rw +yl
  LOC_Os02g49986.1 14 KGPWTADEDQKLVTFLLSNGHCCWRLVPKLAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding57.82.5e-1870111447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++eE++l +d+++qlG++ W++Ia++++ gRt++++k++w+++
  LOC_Os02g49986.1  70 LSEEEEKLVIDLHEQLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                       69*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-19563IPR009057Homeodomain-like
PROSITE profilePS5129413.881961IPR017930Myb domain
SuperFamilySSF466897.49E-2711108IPR009057Homeodomain-like
SMARTSM007175.7E-111363IPR001005SANT/Myb domain
PfamPF002495.4E-131461IPR001005SANT/Myb domain
CDDcd001671.74E-81661No hitNo description
PROSITE profilePS5129427.85562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2564117IPR009057Homeodomain-like
SMARTSM007172.4E-1666114IPR001005SANT/Myb domain
PfamPF002493.0E-1670111IPR001005SANT/Myb domain
CDDcd001679.76E-1471112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRQPCCEKV GLKKGPWTAD EDQKLVTFLL SNGHCCWRLV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEEEEKLVID LHEQLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLKKMG  120
LDPVTHRPVM SLAQPDPLKQ QQQQHEPSVS GGTGADDKEE EEEETPTSAQ PQGVACAASS  180
ASAVSSSCSS SASASAATPG ADVDWPGLFE VDAILDIDWA GLLSACGDDG GCSAIGVDML  240
FDQCSDVGFD QDVWM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-30121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.70510.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329939180.0
Expression AtlasQ6Z2J9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g49986.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g49986
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1087090.0AK108709.1 Oryza sativa Japonica Group cDNA clone:002-150-A10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624871.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX67e-82ODO1_PETHY; Protein ODORANT1
TrEMBLQ6Z2J90.0Q6Z2J9_ORYSJ; Os02g0732600 protein
STRINGLOC_Os02g49986.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.14e-82myb domain protein 20