PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g49880.1
Common NameLOC4330626, Os02g0731700, OSNPB_020731700, P0617A09.30-1, P0643A10.2-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 453aa    MW: 49240.9 Da    PI: 6.2643
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g49880.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.52.7e-081758338
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                      +r C+ + + +++++C  ++ +lC+ C ++ H+       H+
  LOC_Os02g49880.1 17 ARACDSCLRRRARWYCAADDAFLCQGCDTSVHSAnplarrHE 58
                      578*****************************6567777776 PP

2CCT69.67.8e-24399442144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  LOC_Os02g49880.1 399 REARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRP 442
                       9*****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.7221562IPR000315B-box-type zinc finger
SMARTSM003361.6E-111562IPR000315B-box-type zinc finger
PfamPF006433.3E-71859IPR000315B-box-type zinc finger
CDDcd000212.05E-82062No hitNo description
PROSITE profilePS5101716.122399441IPR010402CCT domain
PfamPF062033.1E-18399441IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MSCSSEKAAG AVGGKAARAC DSCLRRRARW YCAADDAFLC QGCDTSVHSA NPLARRHERL  60
RLRVSSPPPL TARASVEEEA AAAVGTTTTT TSKREGGVTP AWSKRKARTR RPQVKSVGQL  120
LSRRLVVPEM AVESSDERKA DEDGAHEELE GQLLYRVPVF DPSLAEFCSP PPIDDAAAAS  180
SSCFKEDAAD GAVEDAKYPA AAASSPVQQL PDSFVNFEPT DAELREFAAD MEALLGQGLD  240
DSNELQDSFY METLGLITPP VEESGRVKME LDGGVASNSR VSLPSCRAHP KPEDVESADV  300
LDIDFNCTSP DEQKSSASNG AAADSQFFHR SLDLRLNYEA IIESWGNSPW TDGRPPHGQL  360
DDFWPNDHHY SGLWAAGGGG HGAEVGMMTV RPRMDGPGRE ARVTRYREKR RTRLFSKKIR  420
YEVRKLNAEK RPRMKGRFVK RPSAAAAPCA VT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1409425RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.502460.0flower| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379899370.0
Expression AtlasQ6Z2L0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g49880.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g49880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1203140.0AK120314.1 Oryza sativa Japonica Group cDNA clone:J013055L13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622659.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0D3FA360.0A0A0D3FA36_9ORYZ; Uncharacterized protein
TrEMBLI1P3X60.0I1P3X6_ORYGL; Uncharacterized protein
TrEMBLQ6Z2L00.0Q6Z2L0_ORYSJ; Os02g0731700 protein
STRINGLOC_Os02g49880.10.0(Oryza sativa Japonica Group)
STRINGORGLA02G0268200.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8021649
MonocotsOGMP32833058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.14e-54B-box type zinc finger protein with CCT domain