PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g49840.3
Common NameLOC4330621, MADS57, Os02g0731200, OsJ_08264, P0617A09.25
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 108aa    MW: 12153.9 Da    PI: 10.7439
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g49840.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.61.9e-291059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      ri+n++ rqvtfskRrng+lKKA+ELS+LCdaev +++fsstg+lye+ss
  LOC_Os02g49840.3 10 RIDNSTSRQVTFSKRRNGLLKKAKELSILCDAEVGLVVFSSTGRLYEFSS 59
                      8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.17161IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-40160IPR002100Transcription factor, MADS-box
CDDcd002656.95E-44277No hitNo description
SuperFamilySSF554554.97E-33277IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELSILCD AEVGLVVFSS TGRLYEFSST  60
NMKTVIDRYT NAKEELLGGN ATSEIKIWQR EAASLRQQLH NLQESHK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-22175175Myocyte-specific enhancer factor 2B
1tqe_Q1e-22175175Myocyte-specific enhancer factor 2B
1tqe_R1e-22175175Myocyte-specific enhancer factor 2B
1tqe_S1e-22175175Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.888580.0callus| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160110090.0
Expression AtlasQ6Z6W2-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedling roots and shoots. {ECO:0000269|PubMed:14701936}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g49840.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q6Z6W2
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g49840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8353721e-180CT835372.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI222G19, full insert sequence.
GenBankAY1777021e-180AY177702.1 Oryza sativa (japonica cultivar-group) transcription factor MADS57 mRNA, complete cds.
GenBankAK2416441e-180AK241644.1 Oryza sativa Japonica Group cDNA, clone: J065189M04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626794.19e-73PREDICTED: MADS-box transcription factor 57 isoform X1
SwissprotQ6Z6W21e-74MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA0A0E0GCU47e-73A0A0E0GCU4_ORYNI; Uncharacterized protein
STRINGLOC_Os02g49840.13e-72(Oryza sativa Japonica Group)
STRINGORGLA02G0267800.13e-72(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.13e-54AGAMOUS-like 16
Publications ? help Back to Top
  1. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  2. Lee S, et al.
    Systematic reverse genetic screening of T-DNA tagged genes in rice for functional genomic analyses: MADS-box genes as a test case.
    Plant Cell Physiol., 2003. 44(12): p. 1403-11
    [PMID:14701936]