PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g49840.2
Common NameLOC4330621, MADS57, Os02g0731200, OsJ_08264, P0617A09.25
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 229aa    MW: 25743.3 Da    PI: 9.9198
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g49840.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.58.8e-291059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      ri+n++ rqvtfskRrng+lKKA+ELS+LCdaev +++fsstg+lye+ss
  LOC_Os02g49840.2 10 RIDNSTSRQVTFSKRRNGLLKKAKELSILCDAEVGLVVFSSTGRLYEFSS 59
                      8***********************************************96 PP

2K-box61.53.4e-2180170999
             K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                       +++++ + +q+e+a L+++++nLq+++++l+Ge+L+ L +++Lq Le++Le sl++iR +K  l++++  el +  + +++++ +L +kl+
  LOC_Os02g49840.2  80 NATSEIKIWQREAASLRQQLHNLQESHKQLMGEELSGLGVRDLQGLENRLEISLRNIRMRKGSLIHQENIELSRSLNVMSQQKLELYNKLQ 170
                       56788999************************************************************99999999999999999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.17161IPR002100Transcription factor, MADS-box
SMARTSM004327.9E-40160IPR002100Transcription factor, MADS-box
CDDcd002651.16E-43277No hitNo description
SuperFamilySSF554554.06E-32275IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-1983169IPR002487Transcription factor, K-box
PROSITE profilePS5129712.79485175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELSILCD AEVGLVVFSS TGRLYEFSST  60
NMKTVIDRYT NAKEELLGGN ATSEIKIWQR EAASLRQQLH NLQESHKQLM GEELSGLGVR  120
DLQGLENRLE ISLRNIRMRK GSLIHQENIE LSRSLNVMSQ QKLELYNKLQ ACEQRGATDA  180
NESSSTPYSF RIIQNANMPP SLELSQSQQR EGECSKTAAP ELGRLHLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-21174174Myocyte-specific enhancer factor 2B
1tqe_R3e-21174174Myocyte-specific enhancer factor 2B
1tqe_Q3e-21174174Myocyte-specific enhancer factor 2B
1tqe_P3e-21174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.888580.0callus| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1160110090.0
Expression AtlasQ6Z6W2-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedling roots and shoots. {ECO:0000269|PubMed:14701936}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g49840.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q6Z6W2
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g49840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8353720.0CT835372.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI222G19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626794.11e-163PREDICTED: MADS-box transcription factor 57 isoform X1
SwissprotQ6Z6W21e-162MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA0A0E0GCU41e-167A0A0E0GCU4_ORYNI; Uncharacterized protein
STRINGLOC_Os02g49840.11e-160(Oryza sativa Japonica Group)
STRINGORGLA02G0267800.11e-160(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.11e-82AGAMOUS-like 16
Publications ? help Back to Top
  1. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  2. Lee S, et al.
    Systematic reverse genetic screening of T-DNA tagged genes in rice for functional genomic analyses: MADS-box genes as a test case.
    Plant Cell Physiol., 2003. 44(12): p. 1403-11
    [PMID:14701936]