PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g49700.1
Common NameHOX16, LOC4330610, Os02g0729700, OsJ_007974, OSJNBa0072H09.24, P0617A09.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 344aa    MW: 37614.2 Da    PI: 4.4431
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g49700.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-2077130356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFqNrRa++k
  LOC_Os02g49700.1  77 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 130
                       5678*************************************************9 PP

2HD-ZIP_I/II132.61.5e-4276168193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktkqlE+d+++Lk+++dal++++++L +++++L++++++
  LOC_Os02g49700.1  76 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFDALRADHDALLQDNHRLHSQVMS 168
                       69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-2071134IPR009057Homeodomain-like
PROSITE profilePS5007118.2272132IPR001356Homeobox domain
SMARTSM003892.0E-2075136IPR001356Homeobox domain
CDDcd000861.20E-2077133No hitNo description
PfamPF000468.3E-1877130IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.0E-2278139IPR009057Homeodomain-like
PRINTSPR000312.3E-6103112IPR000047Helix-turn-helix motif
PROSITE patternPS000270107130IPR017970Homeobox, conserved site
PRINTSPR000312.3E-6112128IPR000047Helix-turn-helix motif
PfamPF021831.8E-18132174IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MESGRLIFST AGSGAGQMLF LDCGAGGGGV GGGAMFHRGA RPVLGMEEGG RGVKRPFFTT  60
PDELLEEEYY DEQLPEKKRR LTPEQVHLLE RSFEEENKLE PERKTELARK LGLQPRQVAV  120
WFQNRRARWK TKQLERDFDR LKASFDALRA DHDALLQDNH RLHSQVMSLT EKLQEKETTT  180
EGSAGAAVDV PGLPAAADVK VAVPDAEEPA LEEAAAAFEE QQEQQVKAED RLSTGSGGSA  240
VVDTDAQLVV GCGRQHLAAV DSSVESYFPG GDEYHDCVMG PMDHAAGGIQ SEEDDGAGSD  300
EGCSYYADDA GVLFADHGHH HHHQHADDDE EDGQQISCWW MWN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124132RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.575450.0callus| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166416600.0
Expression AtlasQ6YWR4-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g49700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g49700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4059600.0CU405960.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C104H10, full insert sequence.
GenBankAK1195920.0AK119592.1 Oryza sativa Japonica Group cDNA clone:002-117-D05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626253.10.0PREDICTED: homeobox-leucine zipper protein HOX16 isoform X1
SwissprotQ6YWR40.0HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLA0A0E0NKG90.0A0A0E0NKG9_ORYRU; Uncharacterized protein
STRINGLOC_Os02g49700.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-58homeobox 1
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]