PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g49440.1
Common NameB1121A12.10, LOC4330589, Os02g0726300, OSNPB_020726300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 283aa    MW: 28962.3 Da    PI: 8.9306
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g49440.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.4e-3942101362
            zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +a+kcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s 
  LOC_Os02g49440.1  42 PEAVKCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRSG 101
                       5789****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-333499IPR003851Zinc finger, Dof-type
PfamPF027013.3E-334499IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4414599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MQEFQSIPGL AGRLFGGAAA ADIRRAQAQQ GPASRCGGIP SPEAVKCPRC ESTNTKFCYY  60
NNYNLSQPRH FCKSCRRYWT KGGVLRNVPV GGGCRKTKRS GSSSAASSAP STPTAATDNA  120
KNQRRASASS PRSSSGGSGN TSPTAAAATT PTTPATPSSN TIAVINHATT TTTTTNPFPT  180
DVPPPAPIFA DQAAALASLF APPPPPPLPV FSFAAQAKTE DGIASVLLAG QTTAPTAATV  240
ADMTPFTSLD AGIFELGDVP PAAYWNAGSC WTDVPDPNVY LP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41850.0callus| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329865300.0
Expression AtlasQ6Z345-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g49440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g49440
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0052840.0AP005284.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1121A12.
GenBankAB0281320.0AB028132.1 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-8.
GenBankAK1013210.0AK101321.1 Oryza sativa Japonica Group cDNA clone:J033034E07, full insert sequence.
GenBankAK0610000.0AK061000.1 Oryza sativa Japonica Group cDNA clone:006-203-F09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623188.10.0PREDICTED: dof zinc finger protein MNB1A
TrEMBLQ6Z3450.0Q6Z345_ORYSJ; Dof zinc finger protein
STRINGLOC_Os02g49440.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.19e-34OBF binding protein 4