PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g49410.1
Common NameB1121A12.5, LOC4330587, NFYB1, OJ1124_G07.28, Os02g0725900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YB
Protein Properties Length: 187aa    MW: 19701.1 Da    PI: 9.219
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g49410.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB134.43.6e-4229122396
             NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                       +++++lP+an++r++kkvlP++aki+ +ak+++++c++ef++fv++eas+k+++e+r+t++++d+l ++++lGf++yv+p+++y++ yre+e+
  LOC_Os02g49410.1  29 ATNAELPMANLVRLIKKVLPGKAKIGGAAKGLTHDCAVEFVGFVGDEASEKAKAEHRRTVAPEDYLGSFGDLGFDRYVDPMDAYIHGYREFER 121
                       68999**************************************************************************************98 PP

             NF-YB  96 e 96 
                       +
  LOC_Os02g49410.1 122 A 122
                       6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.2E-2529122IPR009072Histone-fold
PfamPF008087.5E-133292IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471131.13E-2233152IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MAGNKKRGGR NMDQVKKAAV RSDGVGGSAT NAELPMANLV RLIKKVLPGK AKIGGAAKGL  60
THDCAVEFVG FVGDEASEKA KAEHRRTVAP EDYLGSFGDL GFDRYVDPMD AYIHGYREFE  120
RAGGNRRVAP PPPAAATPLT PGGPTFTDAE LQFLRSVIPS RSDDEYSGSS PAIGGYGYGY  180
GYGKNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-2134118892Transcription factor HapC (Eurofung)
4g92_B2e-2134118892Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.575540.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6Z348
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing kernels. {ECO:0000269|PubMed:11971906}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May act through association with MADS-box proteins. May regulate the expression of genes involved in flowering. {ECO:0000269|PubMed:11971906}.
Function -- GeneRIF ? help Back to Top
  1. Results suggested that the endosperm-specific gene OsNF-YB1/OsHAP3K (AJ300218) might be a cell cycle regulator and played a role in maintaining the endosperm cell proliferation.
    [PMID: 25178525]
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g49410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g49410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8470130.0EU847013.1 Oryza sativa Japonica Group clone KCS012D10 CCAAT-binding transcription factor mRNA, complete cds.
GenBankAK2419200.0AK241920.1 Oryza sativa Japonica Group cDNA, clone: J075074G07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624776.11e-133PREDICTED: nuclear transcription factor Y subunit B-1
SwissprotQ6Z3481e-135NFYB1_ORYSJ; Nuclear transcription factor Y subunit B-1
TrEMBLQ0DXY71e-133Q0DXY7_ORYSJ; CCAAT-binding transcription factor
STRINGLOC_Os02g49410.11e-133(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
MonocotsOGMP136592631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.14e-21nuclear factor Y, subunit B4
Publications ? help Back to Top
  1. Masiero S, et al.
    Ternary complex formation between MADS-box transcription factors and the histone fold protein NF-YB.
    J. Biol. Chem., 2002. 277(29): p. 26429-35
    [PMID:11971906]
  2. Sun X, et al.
    OsNF-YB1, a rice endosperm-specific gene, is essential for cell proliferation in endosperm development.
    Gene, 2014. 551(2): p. 214-21
    [PMID:25178525]