PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g49370.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YB
Protein Properties Length: 179aa    MW: 19254.3 Da    PI: 6.9114
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g49370.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB76.73.5e-242504997
             NF-YB 49 easdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                      ea+++cqre+rkti+++d+lwa++ lGf+dyvepl vyl++yre+ege+
  LOC_Os02g49370.2  2 EANERCQREQRKTITAEDVLWAMSRLGFDDYVEPLGVYLHRYREFEGES 50
                      9*********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-20252IPR009072Histone-fold
SuperFamilySSF471133.35E-17258IPR009072Histone-fold
PfamPF008084.3E-5224IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-7725No hitNo description
PRINTSPR006151.8E-72644No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MEANERCQRE QRKTITAEDV LWAMSRLGFD DYVEPLGVYL HRYREFEGES RGVGVGVGAA  60
RGDHHHGHVG GMLKSRAQGS MVTHHDMQMH AAMYGGGAVP PPPHPPPHHH AFHQLMPPHH  120
GQYAPPYDMY GGEHGMAAYY GGMYAPGSGG DGSGSSGSGG AGTPQTVNFE HQHPFGYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A8e-162455093NF-YB
4awl_B8e-162455194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A8e-162455194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.88910.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329930700.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g49370.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g49370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0041790.0AP004179.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1124_G07.
GenBankAB2880360.0AB288036.1 Oryza sativa Japonica Group OsHAP3E mRNA for HAP3 subunit of HAP complex, complete cds.
GenBankAK1078610.0AK107861.1 Oryza sativa Japonica Group cDNA clone:002-134-B07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624920.11e-126PREDICTED: nuclear transcription factor Y subunit B-10
TrEMBLQ6YNJ71e-127Q6YNJ7_ORYSI; HAP3 transcriptional-activator
STRINGBGIOSGA005701-PA1e-126(Oryza sativa Indica Group)
STRINGORGLA02G0264000.11e-126(Oryza glaberrima)
STRINGLOC_Os02g49370.11e-126(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.23e-27nuclear factor Y, subunit B6