PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g49370.1
Common NameLOC4330586, OJ1124_G07.19, Os02g0725700, OsHAP3E, OsJ_08218, OSNPB_020725700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YB
Protein Properties Length: 255aa    MW: 27147.2 Da    PI: 6.7339
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g49370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB172.54.7e-5431126297
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       reqdr++Pianv+rim++vlPa+akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa++ lGf+dyvepl vyl++yre+e
  LOC_Os02g49370.1  31 REQDRLMPIANVIRIMRRVLPAHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSRLGFDDYVEPLGVYLHRYREFE 123
                       89******************************************************************************************* PP

             NF-YB  95 gek 97 
                       ge+
  LOC_Os02g49370.1 124 GES 126
                       986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.4E-4828128IPR009072Histone-fold
SuperFamilySSF471135.28E-3833134IPR009072Histone-fold
PfamPF008083.9E-2537100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.6E-166482No hitNo description
PROSITE patternPS0068506783IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.6E-1683101No hitNo description
PRINTSPR006152.6E-16102120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MEAGYPGTAA NGAAADGNGG AQQAAAAPAI REQDRLMPIA NVIRIMRRVL PAHAKISDDA  60
KETIQECVSE YISFITGEAN ERCQREQRKT ITAEDVLWAM SRLGFDDYVE PLGVYLHRYR  120
EFEGESRGVG VGVGAARGDH HHGHVGGMLK SRAQGSMVTH HDMQMHAAMY GGGAVPPPPH  180
PPPHHHAFHQ LMPPHHGQYA PPYDMYGGEH GMAAYYGGMY APGSGGDGSG SSGSGGAGTP  240
QTVNFEHQHP FGYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A7e-4029121294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B7e-4029121294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.88910.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329930700.0
Expression AtlasQ6ZFM9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g49370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g49370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0041790.0AP004179.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1124_G07.
GenBankAB2880360.0AB288036.1 Oryza sativa Japonica Group OsHAP3E mRNA for HAP3 subunit of HAP complex, complete cds.
GenBankAK1078610.0AK107861.1 Oryza sativa Japonica Group cDNA clone:002-134-B07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624920.10.0PREDICTED: nuclear transcription factor Y subunit B-10
SwissprotQ84W664e-67NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLQ6ZFM90.0Q6ZFM9_ORYSJ; HAP3 subunit of HAP complex
STRINGLOC_Os02g49370.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16817170
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-62nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Thirumurugan T,Ito Y,Kubo T,Serizawa A,Kurata N
    Identification, characterization and interaction of HAP family genes in rice.
    Mol. Genet. Genomics, 2008. 279(3): p. 279-89
    [PMID:18193457]