PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g49250.1
Common NameOs02g0724400, OsJ_08202, OSNPB_020724400, P0685G12.28
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 282aa    MW: 32224.5 Da    PI: 9.7968
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g49250.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.85.1e-13105149348
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT+eEde+l ++ k+   ++W ++ar+m+ gR++ +c+ rw+ +l
  LOC_Os02g49250.1 105 EWTAEEDERLRRLAKENLFRQWWKVAREMP-GRSGDSCRARWRHHL 149
                       7*****************************.***********9886 PP

2Myb_DNA-binding22.82.1e-07157200348
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       ++T+ +de lv++++  Gg  W++I+r +  gRt    ++rw +++
  LOC_Os02g49250.1 157 PFTARDDEELVRLHRHTGGS-WRKISRSVY-GRTSAIMRDRWIQLR 200
                       79****************88.********9.****99999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.42498153IPR017930Myb domain
SuperFamilySSF466893.18E-20100196IPR009057Homeodomain-like
SMARTSM007175.3E-10102151IPR001005SANT/Myb domain
PfamPF002498.2E-11105148IPR001005SANT/Myb domain
CDDcd001673.68E-10105149No hitNo description
Gene3DG3DSA:1.10.10.604.3E-17105157IPR009057Homeodomain-like
SMARTSM007170.0016154202IPR001005SANT/Myb domain
PROSITE profilePS5129410.852155204IPR017930Myb domain
CDDcd001670.00205157199No hitNo description
Gene3DG3DSA:1.10.10.603.7E-9158200IPR009057Homeodomain-like
PfamPF139215.3E-6158201No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MEEEKEEMAI PAVPVDFFQL MIDGSSKQWR WGRRGESSNR SQWREERLLI EKMSMRKKMQ  60
LGRYPCSRCN QPRSRGGETS MATAAAAAAA AKCRCSRRRR LPEREWTAEE DERLRRLAKE  120
NLFRQWWKVA REMPGRSGDS CRARWRHHLA RDVYHRPFTA RDDEELVRLH RHTGGSWRKI  180
SRSVYGRTSA IMRDRWIQLR RSGLVPDAAK TAENAGCPPP AADDSEYMGS EAELKSPPPP  240
PQQQHPLADV LASSLDSCTL ASDATDPRDG ILALDFAFMS V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3osf_A8e-1310321311120MYB21
3osf_D8e-1310321311120MYB21
3osg_A8e-1310321311120MYB21
3osg_D8e-1310321311120MYB21
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6Z5L1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g49250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g49250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0051130.0AP005113.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0685G12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624539.11e-144PREDICTED: transcription factor MYB98-like
TrEMBLQ6Z5L10.0Q6Z5L1_ORYSJ; Myb-like transcription factor-like
STRINGLOC_Os02g49250.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2205166
Representative plantOGRP10428310
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-22myb domain protein r1