PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g48270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family LBD
Protein Properties Length: 126aa    MW: 13870.9 Da    PI: 7.8534
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g48270.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26051.52.9e-1676245100
            DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                        l++l   ++ da+sslvyeA+ r+rdPvyG+vg i+ +q+q++ql+ +la+++ e
  LOC_Os02g48270.1   7 SLQELLARQQGDAVSSLVYEANDRMRDPVYGCVGAISFMQNQVSQLQMQLAVAQGE 62 
                       688999999******************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.75163IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-14760IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MLARCSSLQE LLARQQGDAV SSLVYEANDR MRDPVYGCVG AISFMQNQVS QLQMQLAVAQ  60
GEILCIQMQH RDGNENKKNL RDLGCTFFAS CGPSRSVAGQ AERFGGLQFI MGRNHFWASI  120
WPIGI*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154633282e-70
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g48270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g48270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149581e-116AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0041651e-116AP004165.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1479_B12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624534.12e-46PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW34e-29LBD12_ARATH; LOB domain-containing protein 12
TrEMBLI1P3J65e-85I1P3J6_ORYGL; Uncharacterized protein
STRINGLOC_Os02g48270.11e-88(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-30LBD family protein