PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g47810.1
Common NameOsJ_35953
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 311aa    MW: 32251.8 Da    PI: 8.2858
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g47810.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.91.3e-3959118261
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                       +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++
  LOC_Os02g47810.1  59 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRA 118
                       7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-3258117IPR003851Zinc finger, Dof-type
PfamPF027013.1E-3360117IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.22763117IPR003851Zinc finger, Dof-type
PROSITE patternPS01361065101IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MMAGAPPMHI CMDSDWLKGI VPEEHGMGSS SPSAELIACP RAPMQAAAAA ADRRLRPQHD  60
QPLKCPRCES THTKFCYYNN YSLSQPRYFC KTCRRYWTKG GSLRNVPVGG GCRKNKRAPP  120
KKAAAHAQPA VAVAAALQGR HMETGLHLSF SGMQHHLAPP PPAAATAADP LCSLGLFDWK  180
QYDPVFAGSG GGGSPVAALE SAGGSEAQFM GAGMMGIGGG GVAEYHALSA LRFAAGLGDH  240
LALPFGAVRA EHDAVEVKPV AAERLLSLEW CGEASRTAAP ESSISSLGGL GLWSGMIGGG  300
HHHHGSSAAI *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.460840.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasB9GCY5
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g47810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g47810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0058440.0AP005844.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBb0060O16.
GenBankAP0053230.0AP005323.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0680A05.
GenBankAF4804960.0AF480496.1 Oryza sativa clone BAC 49D11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623280.10.0PREDICTED: dof zinc finger protein DOF3.1
TrEMBLB9GCY50.0B9GCY5_ORYSJ; Uncharacterized protein
TrEMBLA0A0E0NJV80.0A0A0E0NJV8_ORYRU; Uncharacterized protein
STRINGLOC_Os02g47810.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.19e-36Dof family protein