PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g47770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ZF-HD
Protein Properties Length: 399aa    MW: 41230 Da    PI: 7.0258
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g47770.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer94.49.3e-30160213358
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                       ++rY+eClkNhAa++G+h++DGCgEfm+s+g+   aaal CaACgCHR+FHRre++
  LOC_Os02g47770.1 160 TWRYRECLKNHAARMGAHVLDGCGEFMSSPGDG--AAALACAACGCHRSFHRREPA 213
                       689**************************8887..99****************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047708.4E-26161212IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.2E-26162211IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-9162189IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.485163211IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.606.6E-22311367IPR009057Homeodomain-like
SuperFamilySSF466894.66E-12312367IPR009057Homeodomain-like
TIGRFAMsTIGR015657.9E-20318367IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MEYKRSSHVE EEEEEEEEED DEEEDEEEQG HHQYTTAAAQ QQLHPQVLGS SASSPSSLMD  60
SAAFSRPLLP PNLSLVSPSA AAAAAPGGSY LHAAHHHGQG RRVEAPGGES QHHLQRHHEP  120
ARNGVLGGVA GAHAASTLAL VGGGGGGPRG GEGAAGEAPT WRYRECLKNH AARMGAHVLD  180
GCGEFMSSPG DGAAALACAA CGCHRSFHRR EPAVVAPASL SLCPASASAS AAAGLVSLSP  240
SATPTGANSS RLMPLLLAPP HMQKRPPVLP VSPASAPAAL AESSSEELRP PPLPSSHPHA  300
HAAAVVAASA SAPPGPSKKR FRTKFTAEQK ERMREFAHRV GWRIHKPDAA AVDAFCAQVG  360
VSRRVLKGGD TSTALAAKPP FLRAFAAFFG GQFCLSCF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-163173671666ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.799780.0callus| leaf| panicle
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g47770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g47770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0058440.0AP005844.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBb0060O16.
GenBankAP0053230.0AP005323.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0680A05.
GenBankAF4804960.0AF480496.1 Oryza sativa clone BAC 49D11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626824.11e-165PREDICTED: zinc-finger homeodomain protein 7
SwissprotQ8S3Q91e-167ZHD7_ORYSJ; Zinc-finger homeodomain protein 7
TrEMBLA0A0E0GBX50.0A0A0E0GBX5_ORYNI; Uncharacterized protein
STRINGLOC_Os02g47770.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
MonocotsOGMP134912329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.13e-16homeobox protein 22