PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g47280.2
Common NameGRF4, LOC4330436, OJ1111_E07.19, Os02g0701300, OsJ_08054
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 395aa    MW: 41835.6 Da    PI: 8.5535
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g47280.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.4e-25125169145
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  LOC_Os02g47280.2 125 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 169
                       79****************************************997 PP

2QLQ60.93.5e-216499237
               QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                      +FTaaQ ++L++Q+l+yKyL+a++PvPp+L+++i++
  LOC_Os02g47280.2 64 PFTAAQYEELEQQALIYKYLVAGVPVPPDLVLPIRR 99
                      9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.7E-116399IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.7E-156498IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.8796499IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.486125169IPR014977WRC domain
PfamPF088794.0E-21126168IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MAMPYASLSP AVADHRSSPA AATASLLPFC RSTPLSAGGG GVAMGEDAPM TARWPPAAAA  60
RLPPFTAAQY EELEQQALIY KYLVAGVPVP PDLVLPIRRG LDSLAARFYN HPALGYGPYF  120
GKKLDPEPGR CRRTDGKKWR CSKEAAPDSK YCERHMHRGR NRSRKPVETQ LVAQSQPPSS  180
VVGSAAAPLA AASNGSSFQN HSLYPAIAGS NGGGGGRNMP SSFGSALGSQ LHMDNAAPYA  240
AVGGGTGKDL RYTAYGTRSL ADEQSQLITE AINTSIENPW RLLPSQNSPF PLSSYSQLGA  300
LSDLGQNTPS SLSKVQRQPL SFFGNDYAAV DSVKQENQTL RPFFDEWPKG RDSWSDLADE  360
NANLSSFSGT QLSISIPMAS SDFSAASSRS TNGD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497480.0callus| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329740010.0
Expression AtlasQ6ZIK5-
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g47280.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g47280
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0639830.0AK063983.1 Oryza sativa Japonica Group cDNA clone:001-124-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624297.10.0PREDICTED: growth-regulating factor 4
SwissprotQ6ZIK50.0GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLA0A0E0NJQ40.0A0A0E0NJQ4_ORYRU; Uncharacterized protein
STRINGBGIOSGA005785-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-46growth-regulating factor 5
Publications ? help Back to Top
  1. Ye R,Yao QH,Xu ZH,Xue HW
    Development of an efficient method for the isolation of factors involved in gene transcription during rice embryo development.
    Plant J., 2004. 38(2): p. 348-57
    [PMID:15078336]
  2. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]