PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g47280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 423aa    MW: 45236.5 Da    PI: 9.6764
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g47280.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.81e-24153197145
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  LOC_Os02g47280.1 153 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 197
                       79****************************************997 PP

2QLQ60.83.8e-2192127237
               QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                       +FTaaQ ++L++Q+l+yKyL+a++PvPp+L+++i++
  LOC_Os02g47280.1  92 PFTAAQYEELEQQALIYKYLVAGVPVPPDLVLPIRR 127
                       9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.7E-1191127IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.87992127IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.3E-1592126IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.486153197IPR014977WRC domain
PfamPF088794.4E-21154196IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MPPCLRRWPT TARPRQPRPP PSSPSAAPPR SPRKQREPAA TTHFLGSSGA CDNTVRRCVW  60
VGGCRGGGGV AMGEDAPMTA RWPPAAAARL PPFTAAQYEE LEQQALIYKY LVAGVPVPPD  120
LVLPIRRGLD SLAARFYNHP ALGYGPYFGK KLDPEPGRCR RTDGKKWRCS KEAAPDSKYC  180
ERHMHRGRNR SRKPVETQLV AQSQPPSSVV GSAAAPLAAA SNGSSFQNHS LYPAIAGSNG  240
GGGGRNMPSS FGSALGSQLH MDNAAPYAAV GGGTGKDLRY TAYGTRSLAD EQSQLITEAI  300
NTSIENPWRL LPSQNSPFPL SSYSQLGALS DLGQNTPSSL SKVQRQPLSF FGNDYAAVDS  360
VKQENQTLRP FFDEWPKGRD SWSDLADENA NLSSFSGTQL SISIPMASSD FSAASSRSTN  420
GD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497480.0callus| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329740010.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g47280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g47280
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0639830.0AK063983.1 Oryza sativa Japonica Group cDNA clone:001-124-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624297.10.0PREDICTED: growth-regulating factor 4
SwissprotQ6ZIK50.0GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLA0A0D3F9C70.0A0A0D3F9C7_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g47280.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-46growth-regulating factor 5