PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g47190.1
Common NameLOC4330431, Os02g0700300, OSNPB_020700300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 289aa    MW: 31390.5 Da    PI: 8.9696
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g47190.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-333185155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      kprlrWtp+LHerFveav++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  LOC_Os02g47190.1 31 KPRLRWTPDLHERFVEAVTKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRL 85
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0322888IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-332886IPR009057Homeodomain-like
SuperFamilySSF466891.0E-163188IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-253186IPR006447Myb domain, plants
PfamPF002499.0E-103384IPR001005SANT/Myb domain
PfamPF143791.1E-24130174IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MFEGMERAGY GVGVGGAGAV GAGVVLSRDP KPRLRWTPDL HERFVEAVTK LGGPDKATPK  60
SVLRLMGMKG LTLYHLKSHL QKYRLGKQNK KDTGLEASRG AFAAHGISFA SAAPPTIPSA  120
ENNNAGETPL ADALRYQIEV QRKLHEQLEV QKKLQMRIEA QGKYLQTILE KAQNNLSYDA  180
TGTANLEATR TQLTDFNLAL SGFMNNVSQV CEQNNGELAK AISEDNLRTT NLGFQLYHGI  240
QDSDDVKCSQ DEGLLLLDLN IKGGGYDHLS SNAMRGGESG LKISQHRR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.246990.0leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329694660.0
Expression AtlasQ0DYD6-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g47190.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g47190
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0594480.0AK059448.1 Oryza sativa Japonica Group cDNA clone:001-028-A10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623757.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK59e-52APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0D3F9C20.0A0A0D3F9C2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NJP60.0A0A0E0NJP6_ORYRU; Uncharacterized protein
TrEMBLI1P3D80.0I1P3D8_ORYGL; Uncharacterized protein
TrEMBLA0A0D9YWX90.0A0A0D9YWX9_9ORYZ; Uncharacterized protein
TrEMBLQ0DYD60.0Q0DYD6_ORYSJ; Os02g0700300 protein
STRINGLOC_Os02g47190.10.0(Oryza sativa Japonica Group)
STRINGORGLA02G0249400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.12e-64G2-like family protein