PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g46940.1
Common NameB1053A04.32, LOC107276474, P0666E12.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 315aa    MW: 33389.3 Da    PI: 9.9075
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g46940.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33.1e-32196249255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  LOC_Os02g46940.1 196 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 249
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15194250IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-29194249IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23196250IPR006447Myb domain, plants
PfamPF002491.5E-7197248IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MELFPAHPDL QLQISPPPAT KSMDLGFWKR ALETSTTTTT AAAAASTGPS VATSSSPPVA  60
SGGVGGGAGG FYQQAAVAPA ANGHGHGHGH HHHHHQHHQL GGALQFLHRT QPIPPQDAAA  120
GGGLQDLAFA RPIRGIPVYN TSRPLPFLQS HHLQHHQHCY ADTIGVAPGA GPRSPSKQAA  180
ALRLAAAPAK RGARAPRMRW TTSLHARFVH AVELLGGHER ATPKSVLELM DVKDLTLAHV  240
KSHLQMYRTI KTTDHKQPAP PYGQTKTIIE IPDDNLFDIN NTSGSESSVQ QQSNFDGNEQ  300
GSSMCALRSN NSSR*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6YUI1
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g46940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g46940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0058680.0AP005868.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0666E12.
GenBankAP0058590.0AP005859.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:B1053A04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623607.10.0PREDICTED: probable transcription factor KAN2 isoform X2
TrEMBLQ6YUI10.0Q6YUI1_ORYSJ; Myb family transcription factor-like
STRINGLOC_Os02g46940.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94383445
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-32G2-like family protein