PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g46030.1
Common NameLOC4330349, OJ1212_A08.27, OJ1717_A09.14, Os02g0685200, OsJ_07960, OSNPB_020685200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 492aa    MW: 51674.4 Da    PI: 6.5143
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g46030.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.4e-1661105147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r +WT eE+ l+++a +++G   W++I +++g ++t+ q++s+ qk+
  LOC_Os02g46030.1  61 REKWTDEEHRLFLEALQLHGRA-WRRIQEHIG-TKTAVQIRSHAQKF 105
                       789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-1655109IPR009057Homeodomain-like
PROSITE profilePS5129420.80256110IPR017930Myb domain
TIGRFAMsTIGR015572.2E-1559108IPR006447Myb domain, plants
SMARTSM007172.2E-1360108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-961101IPR009057Homeodomain-like
PfamPF002496.0E-1461104IPR001005SANT/Myb domain
CDDcd001672.88E-1063106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MEMACLPGNA MATDENGADD RAGGESTVDH LRSHMNYGDM DLSGEEHVPK ARKPYTITKQ  60
REKWTDEEHR LFLEALQLHG RAWRRIQEHI GTKTAVQIRS HAQKFFSKVV RESSGSNTGS  120
GGASAAAAAA AIQIPPPRPK RKPAHPYPRK VDGAAKKHVP ALRQLEKPPL WMQSLSEQEE  180
GSPTSVLTAA QIGTEALGGG FSNNSSGSGS LAPSAAGTDE HVDGGGSPAS SVDREDGCLS  240
PSIPTAELAM QAPNTKMSIA TTDAKEASSE ASVFRLFGKS VVVKDSDQLH LLNGSNIATS  300
GSVERATRNI LVPSFAAAPE GSSSNPWPSS MQQFLYFLPR SDGFAAQPVM PWLSYNGSLP  360
CALFYPAAAA AANQQCHRDS EGVEFRVSQR EGSLTGSNTA SSVVLGSSAA VPAAAAAAQN  420
SDVAESRGQG NSREAAASPR LTKCESSASV TLLQRGFMPY KRCAAESELL RSEAAGGEEA  480
VADGELTRLC L*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.81490.0callus| flower| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379883890.0
Expression AtlasQ6ZHD2-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g46030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g46030
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117260.0AK111726.1 Oryza sativa Japonica Group cDNA clone:J023036F23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623484.10.0PREDICTED: protein REVEILLE 1 isoform X2
TrEMBLA0A0E0NJC40.0A0A0E0NJC4_ORYRU; Uncharacterized protein
TrEMBLQ6ZHD20.0Q6ZHD2_ORYSJ; Os02g0685200 protein
STRINGLOC_Os02g46030.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12551549
MonocotsOGMP27223686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.16e-36MYB_related family protein