PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g45770.1
Common NameLOC4330328, MADS6, MFO1, OJ1123_G04.6, Os02g0682200, OsJ_07942
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 251aa    MW: 28437.4 Da    PI: 9.3265
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g45770.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.5e-32958150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  LOC_Os02g45770.1  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                      79**********************************************95 PP

2K-box105.85.4e-3576171499
             K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       +++++++ ++++s+++e++kLk++ e Lqr+qRhllGedL++Ls+keLqqLe+qLe +l++ R++K++l++eq+eel++ke++l e+n++L++
  LOC_Os02g45770.1  76 AQDSNNALSETQSWYHEMSKLKAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERQLGEINRQLKH 168
                       45555778889********************************************************************************** PP

             K-box  97 kle 99 
                       kle
  LOC_Os02g45770.1 169 KLE 171
                       986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.571161IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.74E-45278No hitNo description
SuperFamilySSF554552.49E-33279IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-33323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-3084170IPR002487Transcription factor, K-box
PROSITE profilePS5129717.5586176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0009911Biological Processpositive regulation of flower development
GO:0010094Biological Processspecification of carpel identity
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSA  60
GITKTLERYQ HCCYNAQDSN NALSETQSWY HEMSKLKAKF EALQRTQRHL LGEDLGPLSV  120
KELQQLEKQL ECALSQARQR KTQLMMEQVE ELRRKERQLG EINRQLKHKL EVEGSTSNYR  180
AMQQASWAQG AVVENGAAYV QPPPHSAAMD SEPTLQIGYP HQFVPAEANT IQRSTAPAGA  240
ENNFMLGWVL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D2e-227917010101Developmental protein SEPALLATA 3
4ox0_C2e-227917010101Developmental protein SEPALLATA 3
4ox0_B2e-227917010101Developmental protein SEPALLATA 3
4ox0_A2e-227917010101Developmental protein SEPALLATA 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.72710.0callus| flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2620937580.0
Expression AtlasQ6EU39-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during ovule development in the inner and outer integuments. Not detected in young panicles. {ECO:0000269|PubMed:12395189, ECO:0000269|PubMed:19820190}.
UniprotTISSUE SPECIFICITY: Expressed in the floral meristem. Highly expressed in lodicules. Expressed in palea and pistil. Weakly expressed in carpels, empty glumes and stamens. Not detected in lemmas. {ECO:0000269|PubMed:10444103, ECO:0000269|PubMed:19820190}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269|PubMed:19820190, ECO:0000269|Ref.8}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g45770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q6EU39
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Abnormal and almost sterile florets. Mosaic organs and disturbed identities of palea and lodicule. Extra carpels or spikelets. {ECO:0000269|PubMed:19820190}.
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g45770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7509390.0FJ750939.1 Oryza sativa clone KCS214E02 MADS-box transcription factor 6 mRNA, complete cds.
GenBankFJ6663180.0FJ666318.1 Oryza sativa Japonica Group MOSAIC FLORAL ORGANS 1 (MFO1) mRNA, complete cds.
GenBankAK0691030.0AK069103.1 Oryza sativa Japonica Group cDNA clone:J023006N09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623947.10.0PREDICTED: MADS-box transcription factor 6
SwissprotQ6EU390.0MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLA0A0D3F8Y30.0A0A0D3F8Y3_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9YWH50.0A0A0D9YWH5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NJA10.0A0A0E0NJA1_ORYRU; Uncharacterized protein
TrEMBLD3U2H10.0D3U2H1_ORYSA; MADS-box transcription factor 6
STRINGLOC_Os02g45770.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP41873566
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.11e-101AGAMOUS-like 6
Publications ? help Back to Top
  1. Moon YH, et al.
    Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system.
    Plant Physiol., 1999. 120(4): p. 1193-204
    [PMID:10444103]
  2. Masiero S, et al.
    Ternary complex formation between MADS-box transcription factors and the histone fold protein NF-YB.
    J. Biol. Chem., 2002. 277(29): p. 26429-35
    [PMID:11971906]
  3. Favaro R, et al.
    Ovule-specific MADS-box proteins have conserved protein-protein interactions in monocot and dicot plants.
    Mol. Genet. Genomics, 2002. 268(2): p. 152-9
    [PMID:12395189]
  4. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  5. Lee S, et al.
    Alteration of floral organ identity in rice through ectopic expression of OsMADS16.
    Planta, 2003. 217(6): p. 904-11
    [PMID:12905025]
  6. Fornara F, et al.
    Functional characterization of OsMADS18, a member of the AP1/SQUA subfamily of MADS box genes.
    Plant Physiol., 2004. 135(4): p. 2207-19
    [PMID:15299121]
  7. Ohmori S, et al.
    MOSAIC FLORAL ORGANS1, an AGL6-like MADS box gene, regulates floral organ identity and meristem fate in rice.
    Plant Cell, 2009. 21(10): p. 3008-25
    [PMID:19820190]